For faster navigation, this Iframe is preloading the Wikiwand page for SCN1B.

SCN1B

Матеріал з Вікіпедії — вільної енциклопедії.

SCN1B
Ідентифікатори
Символи SCN1B, ATFB13, BRGDA5, GEFSP1, sodium voltage-gated channel beta subunit 1, EIEE52, DEE52
Зовнішні ІД OMIM: 600235 MGI: 98247 HomoloGene: 810 GeneCards: SCN1B
Пов'язані генетичні захворювання
generalized epilepsy with febrile seizures plus, Brugada syndrome 5[1]
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001037
NM_199037
NM_001321605
NM_011322
RefSeq (білок)
NP_001028
NP_001308534
NP_950238
NP_035452
NP_001389263
Локус (UCSC) Хр. 19: 35.03 – 35.04 Mb Хр. 7: 30.82 – 30.83 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SCN1B (англ. Sodium voltage-gated channel beta subunit 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 218 амінокислот, а молекулярна маса — 24 707[5].

Послідовність амінокислот
1020304050
MGRLLALVVGAALVSSACGGCVEVDSETEAVYGMTFKILCISCKRRSETN
AETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKD
LQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKA
NRDMASIVSEIMMYVLIVVLTIWLVAEMIYCYKKIAAATETAAQENASEY
LAITSESKENCTGVQVAE

Кодований геном білок за функціями належить до іонних каналів, потенціалзалежних каналів. Задіяний у таких біологічних процесах, як клітинна адгезія, транспорт іонів, транспорт, транспорт натрію, альтернативний сплайсинг. Білок має сайт для зв'язування з іоном натрію. Локалізований у клітинній мембрані, мембрані. Також секретований назовні.

Література

[ред. | ред. код]
  • McClatchey A.I., Cannon S.C., Slaugenhaupt S.A., Gusella J.F. (1993). The cloning and expression of a sodium channel beta 1-subunit cDNA from human brain. Hum. Mol. Genet. 2: 745—749. PMID 8394762 DOI:10.1093/hmg/2.6.745
  • Makita N., Sloan-Brown K., Weghuis D.O., Ropers H.-H., George A.L. Jr. (1994). Genomic organization and chromosomal assignment of the human voltage-gated Na+ channel beta 1 subunit gene (SCN1B). Genomics. 23: 628—634. PMID 7851891 DOI:10.1006/geno.1994.1551
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Makita N., Bennett P.B. Jr., George A.L. Jr. (1994). Voltage-gated Na+ channel beta 1 subunit mRNA expressed in adult human skeletal muscle, heart, and brain is encoded by a single gene. J. Biol. Chem. 269: 7571—7578. PMID 8125980

Примітки

[ред. | ред. код]
  1. Захворювання, генетично пов'язані з SCN1B переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:10586 (англ.) . Архів оригіналу за 19 березня 2016. Процитовано 12 вересня 2017.
  5. UniProt, Q07699 (англ.) . Архів оригіналу за 2 липня 2017. Процитовано 12 вересня 2017.

Див. також

[ред. | ред. код]
{{bottomLinkPreText}} {{bottomLinkText}}
SCN1B
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?