For faster navigation, this Iframe is preloading the Wikiwand page for KCNK1.

KCNK1

Матеріал з Вікіпедії — вільної енциклопедії.

KCNK1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KCNK1, DPK, HOHO, K2P1, K2p1.1, KCNO1, TWIK-1, TWIK1, potassium two pore domain channel subfamily K member 1
Зовнішні ІД OMIM: 601745 MGI: 109322 HomoloGene: 1691 GeneCards: KCNK1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002245
NM_008430
RefSeq (білок)
NP_002236
NP_032456
Локус (UCSC) Хр. 1: 233.61 – 233.67 Mb Хр. 8: 126.72 – 126.76 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KCNK1 (англ. Potassium two pore domain channel subfamily K member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 336 амінокислот, а молекулярна маса — 38 143[4].

Послідовність амінокислот
1020304050
MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYED
LLRQELRKLKRRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLSNASGNW
NWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLT
AVVQRITVHVTRRPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPA
AVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGIT
CYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLS
FSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH

Кодований геном білок за функціями належить до іонних каналів, фосфопротеїнів. Задіяний у таких біологічних процесах як транспорт іонів, транспорт, транспорт калію. Білок має сайт для зв'язування з калію. Локалізований у клітинній мембрані, мембрані, клітинних контактах, клітинних відростках, цитоплазматичних везикулах, синапсах, ендосомах.

Література

[ред. | ред. код]
  • Goldstein S.A.N., Wang K.-W., Ilan N., Pausch M.H. (1998). Sequence and function of the two P domain potassium channels: implications of an emerging superfamily. J. Mol. Med. 76: 13—20. PMID 9462864 DOI:10.1007/s109-1998-8100-0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Rajan S., Plant L.D., Rabin M.L., Butler M.H., Goldstein S.A. (2005). Sumoylation silences the plasma membrane leak K+ channel K2P1. Cell. 121: 37—47. PMID 15820677 DOI:10.1016/j.cell.2005.01.019
  • Ma L., Zhang X., Chen H. (2011). TWIK-1 two-pore domain potassium channels change ion selectivity and conduct inward leak sodium currents in hypokalemia. Sci. Signal. 4: RA37—RA37. PMID 21653227 DOI:10.1126/scisignal.2001726
  • Zhao K.Q., Xiong G., Wilber M., Cohen N.A., Kreindler J.L. (2012). A role for two-pore K? channels in modulating Na? absorption and Cl? secretion in normal human bronchial epithelial cells. Am. J. Physiol. 302: L4—L12. PMID 21964404 DOI:10.1152/ajplung.00102.2011
  • Plant L.D., Zuniga L., Araki D., Marks J.D., Goldstein S.A. (2012). SUMOylation silences heterodimeric TASK potassium channels containing K2P1 subunits in cerebellar granule neurons. Sci. Signal. 5: RA84—RA84. PMID 23169818 DOI:10.1126/scisignal.2003431

Примітки

[ред. | ред. код]
  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:6272 (англ.) . Процитовано 25 серпня 2017.((cite web)): Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, O00180 (англ.) . Архів оригіналу за 7 квітня 2017. Процитовано 25 серпня 2017.

Див. також

[ред. | ред. код]
{{bottomLinkPreText}} {{bottomLinkText}}
KCNK1
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?