For faster navigation, this Iframe is preloading the Wikiwand page for CACNB4.

CACNB4

Матеріал з Вікіпедії — вільної енциклопедії.

CACNB4
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CACNB4, CAB4, CACNLB4, EA5, EIG9, EJM, EJM4, EJM6, calcium voltage-gated channel auxiliary subunit beta 4
Зовнішні ІД OMIM: 601949 MGI: 103301 HomoloGene: 20188 GeneCards: CACNB4
Пов'язані генетичні захворювання
episodic ataxia type 5[1]
Реагує на сполуку
bepridil hydrochloride monohydrate[2]
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 2: 151.83 – 152.1 Mb Хр. 2: 52.43 – 52.68 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CACNB4 (англ. Calcium voltage-gated channel auxiliary subunit beta 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [5] Довжина поліпептидного ланцюга білка становить 520 амінокислот, а молекулярна маса — 58 169[6].

Послідовність амінокислот
1020304050
MSSSSYAKNGTADGPHSPTSQVARGTTTRRSRLKRSDGSTTSTSFILRQG
SADSYTSRPSDSDVSLEEDREAIRQEREQQAAIQLERAKSKPVAFAVKTN
VSYCGALDEDVPVPSTAISFDAKDFLHIKEKYNNDWWIGRLVKEGCEIGF
IPSPLRLENIRIQQEQKRGRFHGGKSSGNSSSSLGEMVSGTFRATPTSTA
KQKQKVTEHIPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRF
DGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRSSLAEVQSEIERIF
ELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRG
KSQSKHLNVQLVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAYWR
ATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHSTENSPI
ERRSLMTSDENYHNERARKSRNRLSSSSQHSRDHYPLVEEDYPDSYQDTY
KPHRNRGSPGGYSHDSRHRL

Кодований геном білок за функціями належить до іонних каналів, потенціалзалежних каналів, фосфопротеїнів. Задіяний у таких біологічних процесах як транспорт іонів, транспорт, транспорт кальцію, альтернативний сплайсинг. Білок має сайт для зв'язування з іоном кальцію.

Література

[ред. | ред. код]
  • Taviaux S., Williams M.E., Harpold M.M., Nargeot J., Lory P. (1997). Assignment of human genes for beta 2 and beta 4 subunits of voltage-dependent Ca2+ channels to chromosomes 10p12 and 2q22-q23. Hum. Genet. 100: 151—154. PMID 9254841 DOI:10.1007/s004390050482
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Escayg A., Jones J.M., Kearney J.A., Hitchcock P.F., Meisler M.H. (1998). Calcium channel beta4 (CACNB4): human ortholog of the mouse epilepsy gene lethargic. Genomics. 50: 14—22. PMID 9628818 DOI:10.1006/geno.1998.5311
  • Voss M., Lettau M., Janssen O. (2009). Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening. BMC Immunol. 10: 53—53. PMID 19807924 DOI:10.1186/1471-2172-10-53
  • Vendel A.C., Rithner C.D., Lyons B.A., Horne W.A. (2006). Solution structure of the N-terminal A domain of the human voltage-gated Ca2+channel beta4a subunit. Protein Sci. 15: 378—383. PMID 16385006 DOI:10.1110/ps.051894506
  • Helton T.D., Horne W.A. (2002). Alternative splicing of the beta 4 subunit has alpha 1 subunit subtype-specific effects on Ca2+ channel gating. J. Neurosci. 22: 1573—1582. PMID 11880487

Примітки

[ред. | ред. код]

Див. також

[ред. | ред. код]
{{bottomLinkPreText}} {{bottomLinkText}}
CACNB4
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?