For faster navigation, this Iframe is preloading the Wikiwand page for KCNK4.

KCNK4

Матеріал з Вікіпедії — вільної енциклопедії.

KCNK4
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KCNK4, K2p4.1, TRAAK, TRAAK1, potassium two pore domain channel subfamily K member 4, FHEIG
Зовнішні ІД OMIM: 605720 MGI: 1298234 HomoloGene: 7391 GeneCards: KCNK4
Реагує на сполуку
Рилузол[1]
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_016611
NM_033310
NM_001317090
NM_008431
RefSeq (білок)
NP_001304019
NP_201567
NP_032457
Локус (UCSC) Хр. 11: 64.29 – 64.3 Mb Хр. 19: 6.9 – 6.91 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KCNK4 (англ. Potassium two pore domain channel subfamily K member 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 393 амінокислот, а молекулярна маса — 42 704[5].

Послідовність амінокислот
1020304050
MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAH
PCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSAWDLGSAFFFSGTI
ITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGI
GHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKL
EAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVL
TTIGNWLRVVSRRTRAEMGGLTAQAASWTGTVTARVTQRAGPAAPPPEKE
QPLLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDES
SDTQSERGCPLPRAPRGRRRPNPPRKPVRPRGPGRPRDKGVPV

Кодований геном білок за функціями належить до іонних каналів, потенціалзалежних каналів. Задіяний у таких біологічних процесах, як транспорт іонів, транспорт, транспорт калію, альтернативний сплайсинг. Білок має сайт для зв'язування з калію. Локалізований у клітинній мембрані, мембрані.

Література

[ред. | ред. код]
  • Lesage F., Maingret F., Lazdunski M. (2000). Cloning and expression of human TRAAK, a polyunsaturated fatty acids-activated and mechano-sensitive K(+) channel. FEBS Lett. 471: 137—140. PMID 10767409 DOI:10.1016/S0014-5793(00)01388-0
  • Ozaita A., Vega-Saenz de Miera E. (2002). Cloning of two transcripts, HKT4.1a and HKT4.1b, from the human two-pore K+ channel gene KCNK4. Chromosomal localization, tissue distribution and functional expression. Brain Res. Mol. Brain Res. 102: 18—27. PMID 12191490 DOI:10.1016/S0169-328X(02)00157-2
  • Hillman R.T., Green R.E., Brenner S.E. (2004). An unappreciated role for RNA surveillance. Genome Biol. 5: R8.1—R8.16. PMID 14759258 DOI:10.1186/gb-2004-5-2-r8
  • Brohawn S.G., del Marmol J., MacKinnon R. (2012). Crystal structure of the human K2P TRAAK, a lipid- and mechano-sensitive K+ ion channel. Science. 335: 436—441. PMID 22282805 DOI:10.1126/science.1213808
  • Brohawn S.G., Campbell E.B., MacKinnon R. (2013). Domain-swapped chain connectivity and gated membrane access in a Fab-mediated crystal of the human TRAAK K+ channel. Proc. Natl. Acad. Sci. U.S.A. 110: 2129—2134. PMID 23341632 DOI:10.1073/pnas.1218950110
  • Brohawn S.G., Campbell E.B., MacKinnon R. (2014). Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel. Nature. 516: 126—130. PMID 25471887 DOI:10.1038/nature14013

Примітки

[ред. | ред. код]
  1. Сполуки, які фізично взаємодіють з Potassium two pore domain channel subfamily K member 4 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:6279 (англ.) . Процитовано 8 вересня 2017.((cite web)): Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  5. UniProt, Q9NYG8 (англ.) . Архів оригіналу за 25 вересня 2017. Процитовано 8 вересня 2017.

Див. також

[ред. | ред. код]
{{bottomLinkPreText}} {{bottomLinkText}}
KCNK4
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?