For faster navigation, this Iframe is preloading the Wikiwand page for CATSPER3.

CATSPER3

Матеріал з Вікіпедії — вільної енциклопедії.

CATSPER3
Ідентифікатори
Символи CATSPER3, CACRC, CatSper3, cation channel sperm associated 3
Зовнішні ІД OMIM: 609120 MGI: 1924106 HomoloGene: 12658 GeneCards: CATSPER3
Реагує на сполуку
alprostadil, prostaglandin E2, Прогестерон, mibefradil[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_178019
NM_001252487
NM_001252488
NM_029772
RefSeq (білок)
NP_821138
NP_001239416
NP_001239417
NP_084048
Локус (UCSC) Хр. 5: 134.97 – 135.01 Mb Хр. 13: 55.93 – 55.96 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CATSPER3 (англ. Cation channel sperm associated 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 398 амінокислот, а молекулярна маса — 46 422[5].

Послідовність амінокислот
1020304050
MSQHRHQRHSRVISSSPVDTTSVGFCPTFKKFKRNDDECRAFVKRVIMSR
FFKIIMISTVTSNAFFMALWTSYDIRYRLFRLLEFSEIFFVSICTSELSM
KVYVDPINYWKNGYNLLDVIIIIVMFLPYALRQLMGKQFTYLYIADGMQS
LRILKLIGYSQGIRTLITAVGQTVYTVASVLLLLFLLMYIFAILGFCLFG
SPDNGDHDNWGNLAAAFFTLFSLATVDGWTDLQKQLDNREFALSRAFTII
FILLASFIFLNMFVGVMIMHTEDSIRKFERELMLEQQEMLMGEKQVILQR
QQEEISRLMHIQKNADCTSFSELVENFKKTLSHTDPMVLDDFGTSLPFID
IYFSTLDYQDTTVHKLQELYYEIVHVLSLMLEDLPQEKPQSLEKVDEK

Кодований геном білок за функціями належить до іонних каналів, потенціалзалежних каналів, білків розвитку. Задіяний у таких біологічних процесах як транспорт іонів, транспорт, диференціація, сперматогенез, транспорт кальцію. Білок має сайт для зв'язування з іоном кальцію. Локалізований у клітинній мембрані, мембрані, клітинних відростках, війках.

Література

[ред. | ред. код]
  • Arias J.M., Murbartian J., Perez-Reyes E. (2003). Cloning of a novel one-repeat calcium channel-like gene. Biochem. Biophys. Res. Commun. 303: 31—36. PMID 12646162 DOI:10.1016/S0006-291X(03)00276-6
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Lobley A., Pierron V., Reynolds L., Allen L., Michalovich D. (2003). Identification of human and mouse CatSper3 and CatSper4 genes: characterisation of a common interaction domain and evidence for expression in testis. Reprod. Biol. Endocrinol. 1: 53—53. PMID 12932298 DOI:10.1186/1477-7827-1-53
  • Li H.-G., Ding X.-F., Liao A.-H., Kong X.-B., Xiong C.-L. (2007). Expression of CatSper family transcripts in the mouse testis during post-natal development and human ejaculated spermatozoa: relationship to sperm motility. Mol. Hum. Reprod. 13: 299—306. PMID 17347248 DOI:10.1093/molehr/gam009
  • Lishko P.V., Botchkina I.L., Kirichok Y. (2011). Progesterone activates the principal Ca2+ channel of human sperm. Nature. 471: 387—391. PMID 21412339 DOI:10.1038/nature09767

Примітки

[ред. | ред. код]
  1. Сполуки, які фізично взаємодіють з Cation channel sperm associated 3 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:20819 (англ.) . Процитовано 22 серпня 2017.((cite web)): Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  5. UniProt, Q86XQ3 (англ.) . Архів оригіналу за 10 квітня 2017. Процитовано 22 серпня 2017.

Див. також

[ред. | ред. код]
{{bottomLinkPreText}} {{bottomLinkText}}
CATSPER3
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?