For faster navigation, this Iframe is preloading the Wikiwand page for Ядерний хлорний канал 1.

Ядерний хлорний канал 1

Матеріал з Вікіпедії — вільної енциклопедії.

Ядерний хлорний канал 1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CLIC1, G6, NCC27, chloride intracellular channel 1, CL1C1, CLCNL1
Зовнішні ІД OMIM: 602872 MGI: 2148924 HomoloGene: 20343 GeneCards: CLIC1
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001288
NM_001287593
NM_001287594
NM_033444
RefSeq (білок)
NP_001274522
NP_001274523
NP_001279
NP_254279
Локус (UCSC) Хр. 6: 31.73 – 31.74 Mb Хр. 17: 35.27 – 35.28 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Ядерний хлорний канал 1 (англ. Chloride intracellular channel 1) – білок, який кодується геном CLIC1, розташованим у людей на короткому плечі 6-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 241 амінокислот, а молекулярна маса — 26 923[4].

Послідовність амінокислот
1020304050
MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKR
RTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALN
PESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPE
EVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIP
EAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK

Цей білок за функціями належить до іонних каналів, потенціалзалежних каналів, хлорних каналів. Задіяний у таких біологічних процесах як транспорт іонів, транспорт. Білок має сайт для зв'язування з хлоридом. Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані.

Література

[ред. | ред. код]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Berryman M., Bretscher A. (2000). Identification of a novel member of the chloride intracellular channel gene family (CLIC5) that associates with the actin cytoskeleton of placental microvilli. Mol. Biol. Cell. 11: 1509—1521. PMID 10793131 DOI:10.1091/mbc.11.5.1509
  • Tulk B.M., Kapadia S., Edwards J.C. (2002). CLIC1 inserts from the aqueous phase into phospholipid membranes, where it functions as an anion channel. Am. J. Physiol. 282: C1103—C1112. PMID 11940526 DOI:10.1152/ajpcell.00402.2001
  • Fan L., Yu W., Zhu X. (2003). Interaction of sedlin with chloride intracellular channel proteins. FEBS Lett. 540: 77—80. PMID 12681486 DOI:10.1016/S0014-5793(03)00228-X
  • Fanucchi S., Adamson R.J., Dirr H.W. (2008). Formation of an unfolding intermediate state of soluble chloride intracellular channel protein CLIC1 at acidic pH. Biochemistry. 47: 11674—11681. PMID 18850721 DOI:10.1021/bi801147r
  • Chuang J.Z., Milner T.A., Zhu M., Sung C.H. (1999). A 29 kDa intracellular chloride channel p64H1 is associated with large dense-core vesicles in rat hippocampal neurons. J. Neurosci. 19: 2919—2928. PMID 10191309

Примітки

[ред. | ред. код]
  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:2062 (англ.) . Процитовано 28 лютого 2017.((cite web)): Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, O00299 (англ.) . Процитовано 28 лютого 2017.

Див. також

[ред. | ред. код]
{{bottomLinkPreText}} {{bottomLinkText}}
Ядерний хлорний канал 1
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?