For faster navigation, this Iframe is preloading the Wikiwand page for EIF6.

EIF6

Матеріал з Вікіпедії — вільної енциклопедії.

EIF6
Ідентифікатори
Символи EIF6, CAB, EIF3A, ITGB4BP, b(2)gcn, eIF-6, p27(BBP), p27BBP, eukaryotic translation initiation factor 6
Зовнішні ІД OMIM: 602912 MGI: 1196288 HomoloGene: 7135 GeneCards: EIF6
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_010579
RefSeq (білок)
NP_001254739
NP_002203
NP_852131
NP_852133
NP_034709
Локус (UCSC) Хр. 20: 35.28 – 35.28 Mb Хр. 2: 155.66 – 155.67 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

EIF6 (англ. Eukaryotic translation initiation factor 6) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 245 амінокислот, а молекулярна маса — 26 599[4].

Послідовність амінокислот
1020304050
MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVH
ASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEER
LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGS
YCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVN
DWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT

Кодований геном білок за функцією належить до факторів ініціації. Задіяний у таких біологічних процесах як біосинтез білка, біогенез рибосом. Локалізований у цитоплазмі, ядрі.

Література

[ред. | ред. код]
  • Si K., Chaudhuri J., Chevesich J., Maitra U. (1997). Molecular cloning and functional expression of a human cDNA encoding translation initiation factor 6. Proc. Natl. Acad. Sci. U.S.A. 94: 14285—14290. PMID 9405604 DOI:10.1073/pnas.94.26.14285
  • Donadini A., Giodini A., Sanvito F., Marchisio P.C., Biffo S. (2001). The human ITGB4BP gene is constitutively expressed in vitro, but highly modulated in vivo. Gene. 266: 35—43. PMID 11290417 DOI:10.1016/S0378-1119(01)00370-5
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Basu U., Si K., Deng H., Maitra U. (2003). Phosphorylation of mammalian eukaryotic translation initiation factor 6 and its Saccharomyces cerevisiae homologue Tif6p: evidence that phosphorylation of Tif6p regulates its nucleocytoplasmic distribution and is required for yeast cell growth. Mol. Cell. Biol. 23: 6187—6199. PMID 12917340 DOI:10.1128/MCB.23.17.6187-6199.2003

Примітки

[ред. | ред. код]
  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:6159 (англ.) . Архів оригіналу за 14 жовтня 2017. Процитовано 21 серпня 2017.
  4. UniProt, P56537 (англ.) . Архів оригіналу за 17 вересня 2017. Процитовано 21 серпня 2017.

Див. також

[ред. | ред. код]
{{bottomLinkPreText}} {{bottomLinkText}}
EIF6
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?