For faster navigation, this Iframe is preloading the Wikiwand page for EIF3F.

EIF3F

Матеріал з Вікіпедії — вільної енциклопедії.

EIF3F
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи EIF3F, EIF3S5, eIF3-p47, eukaryotic translation initiation factor 3 subunit F, MRT67
Зовнішні ІД OMIM: 603914 MGI: 1913335 HomoloGene: 2783 GeneCards: EIF3F
шифр КФ 3.4.19.12
Пов'язані генетичні захворювання
депресія клінічна[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003754
NM_025344
RefSeq (білок)
NP_003745
NP_079620
Локус (UCSC) Хр. 11: 7.97 – 8 Mb Хр. 7: 108.53 – 108.54 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

EIF3F (англ. Eukaryotic translation initiation factor 3 subunit F) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 357 амінокислот, а молекулярна маса — 37 564[5].

Послідовність амінокислот
1020304050
MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPA
AAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILA
SIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDM
EFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHL
TVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVD
LIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSA
DNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIAL
NEKLVNL

Кодований геном білок за функціями належить до гідролаз, протеаз, факторів ініціації, тіолових протеаз. Задіяний у таких біологічних процесах як біосинтез білка, убіквітинування білків. Локалізований у цитоплазмі.

Література

[ред. | ред. код]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Holz M.K., Ballif B.A., Gygi S.P., Blenis J. (2005). mTOR and S6K1 mediate assembly of the translation preinitiation complex through dynamic protein interchange and ordered phosphorylation events. Cell. 123: 569—580. PMID 16286006 DOI:10.1016/j.cell.2005.10.024
  • Kolupaeva V.G., Unbehaun A., Lomakin I.B., Hellen C.U.T., Pestova T.V. (2005). Binding of eukaryotic initiation factor 3 to ribosomal 40S subunits and its role in ribosomal dissociation and anti-association. RNA. 11: 470—486. PMID 15703437 DOI:10.1261/rna.7215305
  • Masutani M., Sonenberg N., Yokoyama S., Imataka H. (2007). Reconstitution reveals the functional core of mammalian eIF3. EMBO J. 26: 3373—3383. PMID 17581632 DOI:10.1038/sj.emboj.7601765
  • Lee A.S., Kranzusch P.J., Cate J.H. (2015). eIF3 targets cell-proliferation messenger RNAs for translational activation or repression. Nature. 522: 111—114. PMID 25849773 DOI:10.1038/nature14267
  • Lee A.S., Kranzusch P.J., Doudna J.A., Cate J.H. (2016). eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation. Nature. 536: 96—99. PMID 27462815 DOI:10.1038/nature18954

Примітки

[ред. | ред. код]
  1. Захворювання, генетично пов'язані з EIF3F переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:3275 (англ.) . Архів оригіналу за 10 вересня 2015. Процитовано 21 серпня 2017.
  5. UniProt, O00303 (англ.) . Архів оригіналу за 27 вересня 2017. Процитовано 21 серпня 2017.

Див. також

[ред. | ред. код]
{{bottomLinkPreText}} {{bottomLinkText}}
EIF3F
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?