For faster navigation, this Iframe is preloading the Wikiwand page for EIF4A3.

EIF4A3

Матеріал з Вікіпедії — вільної енциклопедії.

EIF4A3
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи EIF4A3, DDX48, MUK34, NMP265, NUK34, RCPS, eIF4AIII, eukaryotic translation initiation factor 4A3, Fal1, eIF4A-III, eIF-4A-III
Зовнішні ІД OMIM: 608546 MGI: 1923731 HomoloGene: 5602 GeneCards: EIF4A3
Пов'язані генетичні захворювання
Richieri Costa-Pereira syndrome[1]
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_014740
NM_138669
RefSeq (білок)
NP_055555
NP_619610
Локус (UCSC) Хр. 17: 80.13 – 80.15 Mb Хр. 11: 119.18 – 119.19 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

EIF4A3 (англ. Eukaryotic translation initiation factor 4A3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 411 амінокислот, а молекулярна маса — 46 871[5].

Послідовність амінокислот
1020304050
MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLL
RGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCL
DIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDI
RKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQ
IYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEG
IKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREA
NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLII
NYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQI
DEMPMNVADLI

Кодований геном білок за функціями належить до гідролаз, геліказ. Задіяний у таких біологічних процесах як регуляція трансляції, процесінг мРНК, сплайсінг мРНК, транспорт, процесинг рРНК, транспорт мРНК. Білок має сайт для зв'язування з АТФ, нуклеотидами, РНК. Локалізований у цитоплазмі, ядрі.

Література

[ред. | ред. код]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Jurica M.S., Licklider L.J., Gygi S.P., Grigorieff N., Moore M.J. (2002). Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis. RNA. 8: 426—439. PMID 11991638 DOI:10.1017/S1355838202021088
  • Shibuya T., Tange T.O., Sonenberg N., Moore M.J. (2004). eIF4AIII binds spliced mRNA in the exon junction complex and is essential for nonsense-mediated decay. Nat. Struct. Mol. Biol. 11: 346—351. PMID 15034551 DOI:10.1038/nsmb750
  • Simmons H.M., Ruis B.L., Kapoor M., Hudacek A.W., Conklin K.F. (2005). Identification of NOM1, a nucleolar, eIF4A binding protein encoded within the chromosome 7q36 breakpoint region targeted in cases of pediatric acute myeloid leukemia. Gene. 347: 137—145. PMID 15715967 DOI:10.1016/j.gene.2004.12.027
  • Tange T.O., Shibuya T., Jurica M.S., Moore M.J. (2005). Biochemical analysis of the EJC reveals two new factors and a stable tetrameric protein core. RNA. 11: 1869—1883. PMID 16314458 DOI:10.1261/rna.2155905
  • Shibuya T., Tange T.O., Stroupe M.E., Moore M.J. (2006). Mutational analysis of human eIF4AIII identifies regions necessary for exon junction complex formation and nonsense-mediated mRNA decay. RNA. 12: 360—374. PMID 16495234 DOI:10.1261/rna.2190706

Примітки

[ред. | ред. код]
  1. Захворювання, генетично пов'язані з EIF4A3 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:18683 (англ.) . Архів оригіналу за 10 вересня 2015. Процитовано 28 лютого 2017.
  5. UniProt, P38919 (англ.) . Архів оригіналу за 24 березня 2017. Процитовано 28 лютого 2017.

Див. також

[ред. | ред. код]
{{bottomLinkPreText}} {{bottomLinkText}}
EIF4A3
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?