For faster navigation, this Iframe is preloading the Wikiwand page for EIF4H.

EIF4H

Матеріал з Вікіпедії — вільної енциклопедії.

EIF4H
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи EIF4H, WBSCR1, WSCR1, eIF-4H, eukaryotic translation initiation factor 4H
Зовнішні ІД OMIM: 603431 MGI: 1341822 HomoloGene: 32536 GeneCards: EIF4H
Реагує на сполуку
Viroporin 3a[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_022170
NM_031992
NM_033561
NM_001312867
RefSeq (білок)
NP_071496
NP_114381
NP_001299796
NP_291039
Локус (UCSC) Хр. 7: 74.17 – 74.2 Mb Хр. 5: 134.65 – 134.67 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

EIF4H (англ. Eukaryotic translation initiation factor 4H) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 248 амінокислот, а молекулярна маса — 27 385[5].

Послідовність амінокислот
1020304050
MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLP
FNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALT
YDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGMGSSRESRGGWDS
RDDFNSGFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFREP
TEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE

Кодований геном білок за функціями належить до факторів ініціації, фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, біосинтез білка, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з РНК. Локалізований у цитоплазмі.

Література

[ред. | ред. код]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Richter-Cook N.J., Dever T.E., Hensold J.O., Merrick W.C. (1998). Purification and characterization of a new eukaryotic protein translation factor. Eukaryotic initiation factor 4H. J. Biol. Chem. 273: 7579—7587. PMID 9516461 DOI:10.1074/jbc.273.13.7579
  • Richter N.J., Rogers G.W. Jr., Hensold J.O., Merrick W.C. (1999). Further biochemical and kinetic characterization of human eukaryotic initiation factor 4H. J. Biol. Chem. 274: 35415—35424. PMID 10585411 DOI:10.1074/jbc.274.50.35415
  • Rogers G.W. Jr., Richter N.J., Lima W.F., Merrick W.C. (2001). Modulation of the helicase activity of eIF4A by eIF4B, eIF4H, and eIF4F. J. Biol. Chem. 276: 30914—30922. PMID 11418588 DOI:10.1074/jbc.M100157200
  • Feng P., Everly D.N. Jr., Read G.S. (2005). mRNA decay during herpes simplex virus (HSV) infections: protein-protein interactions involving the HSV virion host shutoff protein and translation factors eIF4H and eIF4A. J. Virol. 79: 9651—9664. PMID 16014927 DOI:10.1128/JVI.79.15.9651-9664.2005

Примітки

[ред. | ред. код]

Див. також

[ред. | ред. код]
{{bottomLinkPreText}} {{bottomLinkText}}
EIF4H
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?