For faster navigation, this Iframe is preloading the Wikiwand page for EIF3E.

EIF3E

Матеріал з Вікіпедії — вільної енциклопедії.

EIF3E
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи EIF3E, EIF3-P48, EIF3S6, INT6, eIF3-p46, eukaryotic translation initiation factor 3 subunit E
Зовнішні ІД OMIM: 602210 MGI: 99257 HomoloGene: 1205 GeneCards: EIF3E
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001568
NM_008388
RefSeq (білок)
NP_001559
NP_032414
Локус (UCSC) Хр. 8: 108.16 – 108.44 Mb Хр. 15: 43.11 – 43.15 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

EIF3E (англ. Eukaryotic translation initiation factor 3 subunit E) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 445 амінокислот, а молекулярна маса — 52 221[4].

Послідовність амінокислот
1020304050
MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNM
VDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPET
TRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEY
LYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNS
VSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMC
PHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLY
VNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQC
ISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSP
YQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY

Кодований геном білок за функцією належить до факторів ініціації. Задіяний у такому біологічному процесі як біосинтез білка. Локалізований у цитоплазмі, ядрі.

Література

[ред. | ред. код]
  • Asano K., Merrick W.C., Hershey J.W.B. (1997). The translation initiation factor eIF3-p48 subunit is encoded by int-6, a site of frequent integration by the mouse mammary tumor virus genome. J. Biol. Chem. 272: 23477—23480. PMID 9295280 DOI:10.1074/jbc.272.38.23477
  • Desbois C., Rousset R., Bantignies F., Jalinot P. (1996). Exclusion of Int-6 from PML nuclear bodies by binding to the HTLV-I Tax oncoprotein. Science. 273: 951—953. PMID 8688078 DOI:10.1126/science.273.5277.951
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Morris-Desbois C., Rety S., Ferro M., Garin J., Jalinot P. (2001). The human protein HSPC021 interacts with Int-6 and is associated with eukaryotic translation initiation factor 3. J. Biol. Chem. 276: 45988—45995. PMID 11590142 DOI:10.1074/jbc.M104966200
  • Hoareau Alves K., Bochard V., Rety S., Jalinot P. (2002). Association of the mammalian proto-oncoprotein Int-6 with the three protein complexes eIF3, COP9 signalosome and 26S proteasome. FEBS Lett. 527: 15—21. PMID 12220626 DOI:10.1016/S0014-5793(02)03147-2
  • Kolupaeva V.G., Unbehaun A., Lomakin I.B., Hellen C.U.T., Pestova T.V. (2005). Binding of eukaryotic initiation factor 3 to ribosomal 40S subunits and its role in ribosomal dissociation and anti-association. RNA. 11: 470—486. PMID 15703437 DOI:10.1261/rna.7215305

Примітки

[ред. | ред. код]
  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:3277 (англ.) . Архів оригіналу за 11 вересня 2015. Процитовано 22 серпня 2017.
  4. UniProt, P60228 (англ.) . Архів оригіналу за 7 грудня 2017. Процитовано 22 серпня 2017.

Див. також

[ред. | ред. код]
{{bottomLinkPreText}} {{bottomLinkText}}
EIF3E
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?