For faster navigation, this Iframe is preloading the Wikiwand page for EIF3I.

EIF3I

Матеріал з Вікіпедії — вільної енциклопедії.

EIF3I
Ідентифікатори
Символи EIF3I, EIF3S2, PRO2242, TRIP-1, TRIP1, eIF3-beta, eIF3-p36, eukaryotic translation initiation factor 3 subunit I
Зовнішні ІД OMIM: 603911 MGI: 1860763 HomoloGene: 2786 GeneCards: EIF3I
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003757
NM_001394168
NM_018799
RefSeq (білок)
NP_003748
NP_061269
Локус (UCSC) Хр. 1: 32.22 – 32.25 Mb Хр. 4: 129.49 – 129.49 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

EIF3I (англ. Eukaryotic translation initiation factor 3 subunit I) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 325 амінокислот, а молекулярна маса — 36 502[4].

Послідовність амінокислот
1020304050
MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMG
HTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCG
FDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDNNEPYMKIPCNDSKIT
SAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDM
TMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQ
EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSY
SSGGEDGYVRIHYFDPQYFEFEFEA

Кодований геном білок за функцією належить до факторів ініціації. Задіяний у такому біологічному процесі як біосинтез білка. Локалізований у цитоплазмі.

Література

[ред. | ред. код]
  • Asano K., Kinzy T.G., Merrick W.C., Hershey J.W.B. (1997). Conservation and diversity of eukaryotic translation initiation factor eIF3. J. Biol. Chem. 272: 1101—1109. PMID 8995409 DOI:10.1074/jbc.272.28.17668
  • Chen R.H., Miettinen P.J., Maruka E.M., Choy L., Derynck R. (1995). A WD-domain protein that is associated with and phosphorylated by the type II TGF-beta receptor. Nature. 377: 548—552. PMID 7566156 DOI:10.1038/377548a0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Mayeur G.L., Fraser C.S., Peiretti F., Block K.L., Hershey J.W.B. (2003). Characterization of eIF3k: a newly discovered subunit of mammalian translation initiation factor eIF3. Eur. J. Biochem. 270: 4133—4139. PMID 14519125 DOI:10.1046/j.1432-1033.2003.03807.x
  • Kolupaeva V.G., Unbehaun A., Lomakin I.B., Hellen C.U.T., Pestova T.V. (2005). Binding of eukaryotic initiation factor 3 to ribosomal 40S subunits and its role in ribosomal dissociation and anti-association. RNA. 11: 470—486. PMID 15703437 DOI:10.1261/rna.7215305
  • Masutani M., Sonenberg N., Yokoyama S., Imataka H. (2007). Reconstitution reveals the functional core of mammalian eIF3. EMBO J. 26: 3373—3383. PMID 17581632 DOI:10.1038/sj.emboj.7601765

Примітки

[ред. | ред. код]
  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:3272 (англ.) . Архів оригіналу за 11 вересня 2015. Процитовано 22 серпня 2017.
  4. UniProt, Q13347 (англ.) . Архів оригіналу за 23 вересня 2017. Процитовано 22 серпня 2017.

Див. також

[ред. | ред. код]


{{bottomLinkPreText}} {{bottomLinkText}}
EIF3I
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?