For faster navigation, this Iframe is preloading the Wikiwand page for TAL1.

TAL1

TAL1
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2YPA, 2YPB

Identifikatori
AliasiTAL1
Vanjski ID-jeviOMIM: 187040 MGI: 98480 HomoloGene: 2400 GeneCards: TAL1
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za TAL1
Genomska lokacija za TAL1
Bend1p33Početak47,216,290 bp[1]
Kraj47,232,225 bp[1]
Lokacija gena (miš)
Hromosom 4 (miš)
Hrom.Hromosom 4 (miš)[2]
Hromosom 4 (miš)
Genomska lokacija za TAL1
Genomska lokacija za TAL1
Bend4 D1|4 52.73 cMPočetak114,913,623 bp[2]
Kraj114,928,952 bp[2]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0000980 RNA polymerase II cis-regulatory region sequence-specific DNA binding
vezivanje sa DNK
RNA polymerase II transcription regulatory region sequence-specific DNA binding
protein dimerization activity
GO:0001131, GO:0001151, GO:0001130, GO:0001204 DNA-binding transcription factor activity
histone deacetylase binding
chromatin binding
GO:0000975 transcription cis-regulatory region binding
E-box binding
GO:0001948, GO:0016582 vezivanje za proteine
protein heterodimerization activity
vezivanje enzima
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
Ćelijska komponenta histone deacetylase complex
transcription regulator complex
Lsd1/2 complex
jedro
nukleoplazma
GO:0009327 makromolekulani kompleks
Biološki proces megakaryocyte development
megakaryocyte differentiation
myeloid cell differentiation
cell fate commitment
Ćelijska diferencijacija
GO:0009373 regulation of transcription, DNA-templated
regulation of mast cell differentiation
spinal cord association neuron differentiation
positive regulation of protein-containing complex assembly
locomotory behavior
positive regulation of erythrocyte differentiation
GO:0044324, GO:0003256, GO:1901213, GO:0046019, GO:0046020, GO:1900094, GO:0061216, GO:0060994, GO:1902064, GO:0003258, GO:0072212 regulation of transcription by RNA polymerase II
regulation of stem cell population maintenance
platelet formation
positive regulation of mitotic cell cycle
GO:1901227 negative regulation of transcription by RNA polymerase II
transcription, DNA-templated
generation of neurons
basophil differentiation
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
multicellular organism development
regulation of cell population proliferation
hematopoietic stem cell differentiation
astrocyte fate commitment
Angiogeneza
neuron differentiation
embryonic hemopoiesis
erythrocyte differentiation
definitive hemopoiesis
regulation of myeloid cell differentiation
positive regulation of cell division
hemangioblast cell differentiation
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
erythrocyte maturation
regulation of hematopoietic stem cell differentiation
Hematopoeza
transcription by RNA polymerase II
negative regulation of erythrocyte differentiation
positive regulation of protein tyrosine kinase activity
positive regulation of signaling receptor activity
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)
NM_001287347
NM_001290403
NM_001290404
NM_001290405
NM_001290406

NM_003189

NM_011527
NM_001287388

RefSeq (bjelančevina)
NP_001274276
NP_001277332
NP_001277333
NP_001277334
NP_001277335

NP_003180

NP_001274317
NP_035657

Lokacija (UCSC)Chr 1: 47.22 – 47.23 MbChr 4: 114.91 – 114.93 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Protein 1 T-ćelijske akutne limfocistne leukemije (tj. TAL1, također zvana leukemija matičnih ćelija/akutna leukemija T-ćelija 1 (tj. SCL/TAL1]) jest protein koji je kod ljudi kodiran genom TAL1 sa hromosoma 1.[5][6]

Aminokiselinska sekvenca

[uredi | uredi izvor]

Dužina polipeptidnog lanca je 331 aminokiselina, a molekulska težina 34.271 Da.[7]

1020304050
MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPP
VIELGARGGPGGGPAGGGGAARDLKGRDAATAEARHRVPTTELCRPPGPA
PAPAPASVTAELPGDGRMVQLSPPALAAPAAPGRALLYSLSQPLASLGSG
FFGEPDAFPMFTTNNRVKRRPSPYEMEITDGPHTKVVRRIFTNSRERWRQ
QNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEG
TQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAAS
PDSYTEEPAPKHTARSLHPAMLPAADGAGPR

Funkcija

[uredi | uredi izvor]

Protein koji kodira TAL1 je transkripcijski faktor zvani bazni heliks-petkja-heliks.

Interakcije

[uredi | uredi izvor]

Pokazalo se da je TAL1 u interakcijama sa:

Reference

[uredi | uredi izvor]
  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000162367 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000028717 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Finger LR, Kagan J, Christopher G, Kurtzberg J, Hershfield MS, Nowell PC, Croce CM (august 1989). "Involvement of the TCL5 gene on human chromosome 1 in T-cell leukemia and melanoma". Proc Natl Acad Sci U S A. 86 (13): 5039–43. Bibcode:1989PNAS...86.5039F. doi:10.1073/pnas.86.13.5039. PMC 297552. PMID 2740341.
  6. ^ "Entrez Gene: TAL1 T-cell acute lymphocytic leukemia 1".
  7. ^ "UniProt, P17542" (jezik: en.). Pristupljeno 5. 12. 2021.CS1 održavanje: nepoznati jezik (link)
  8. ^ a b c d e Goardon N, Lambert JA, Rodriguez P, Nissaire P, Herblot S, Thibault P, Dumenil D, Strouboulis J, Romeo PH, Hoang T (januar 2006). "ETO2 coordinates cellular proliferation and differentiation during erythropoiesis". EMBO J. 25 (2): 357–66. doi:10.1038/sj.emboj.7600934. PMC 1383517. PMID 16407974.
  9. ^ Huang S, Qiu Y, Stein RW, Brandt SJ (septembar 1999). "p300 functions as a transcriptional coactivator for the TAL1/SCL oncoprotein". Oncogene. 18 (35): 4958–67. doi:10.1038/sj.onc.1202889. PMID 10490830.
  10. ^ a b Osada H, Grutz G, Axelson H, Forster A, Rabbitts TH (oktobar 1995). "Association of erythroid transcription factors: complexes involving the LIM protein RBTN2 and the zinc-finger protein GATA1". Proc. Natl. Acad. Sci. U.S.A. 92 (21): 9585–9. Bibcode:1995PNAS...92.9585O. doi:10.1073/pnas.92.21.9585. PMC 40846. PMID 7568177.
  11. ^ a b Valge-Archer VE, Osada H, Warren AJ, Forster A, Li J, Baer R, Rabbitts TH (august 1994). "The LIM protein RBTN2 and the basic helix-loop-helix protein TAL1 are present in a complex in erythroid cells". Proc. Natl. Acad. Sci. U.S.A. 91 (18): 8617–21. Bibcode:1994PNAS...91.8617V. doi:10.1073/pnas.91.18.8617. PMC 44657. PMID 8078932.
  12. ^ a b Wadman I, Li J, Bash RO, Forster A, Osada H, Rabbitts TH, Baer R (oktobar 1994). "Specific in vivo association between the bHLH and LIM proteins implicated in human T cell leukemia". EMBO J. 13 (20): 4831–9. doi:10.1002/j.1460-2075.1994.tb06809.x. PMC 395422. PMID 7957052.
  13. ^ Huang S, Brandt SJ (mart 2000). "mSin3A regulates murine erythroleukemia cell differentiation through association with the TAL1 (or SCL) transcription factor". Mol. Cell. Biol. 20 (6): 2248–59. doi:10.1128/mcb.20.6.2248-2259.2000. PMC 110841. PMID 10688671.
  14. ^ Lécuyer E, Herblot S, Saint-Denis M, Martin R, Begley CG, Porcher C, Orkin SH, Hoang T (oktobar 2002). "The SCL complex regulates c-kit expression in hematopoietic cells through functional interaction with Sp1". Blood. 100 (7): 2430–40. doi:10.1182/blood-2002-02-0568. PMID 12239153.
  15. ^ Hsu HL, Wadman I, Baer R (april 1994). "Formation of in vivo complexes between the TAL1 and E2A polypeptides of leukemic T cells". Proc. Natl. Acad. Sci. U.S.A. 91 (8): 3181–5. Bibcode:1994PNAS...91.3181H. doi:10.1073/pnas.91.8.3181. PMC 43539. PMID 8159721.

Dopunska literatura

[uredi | uredi izvor]

Vanjski linkovi

[uredi | uredi izvor]
{{bottomLinkPreText}} {{bottomLinkText}}
TAL1
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?