For faster navigation, this Iframe is preloading the Wikiwand page for HES3.

HES3

HES3
Identifikatori
AliasiHES3
Vanjski ID-jeviOMIM: 609971 MGI: 104877 HomoloGene: 7358 GeneCards: HES3
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za HES3
Genomska lokacija za HES3
Bend1p36.31Početak6,244,179 bp[1]
Kraj6,245,578 bp[1]
Lokacija gena (miš)
Hromosom 4 (miš)
Hrom.Hromosom 4 (miš)[2]
Hromosom 4 (miš)
Genomska lokacija za HES3
Genomska lokacija za HES3
Bend4 E2|4 83.01 cMPočetak152,370,429 bp[2]
Kraj152,376,119 bp[2]
Ontologija gena
Molekularna funkcija vezivanje sa DNK
transcription factor binding
protein dimerization activity
GO:0000980 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001078, GO:0001214, GO:0001206 DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001106 transcription corepressor activity
sequence-specific DNA binding
sequence-specific double-stranded DNA binding
Ćelijska komponenta jedro
Biološki proces hindbrain morphogenesis
trochlear nerve development
midbrain-hindbrain boundary morphogenesis
GO:0045996 negative regulation of transcription, DNA-templated
in utero embryonic development
GO:1901227 negative regulation of transcription by RNA polymerase II
GO:0009373 regulation of transcription, DNA-templated
regulation of timing of neuron differentiation
regulation of neurogenesis
oculomotor nerve development
transcription, DNA-templated
midbrain development
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
neural tube development
somitogenesis
Notch signaling pathway
Ćelijska diferencijacija
anterior/posterior pattern specification
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001024598

NM_008237

RefSeq (bjelančevina)

NP_001019769

NP_032263
NP_001390720
NP_001390721
NP_001390722
NP_001390723

Lokacija (UCSC)Chr 1: 6.24 – 6.25 MbChr 4: 152.37 – 152.38 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Transkripcijski faktor 3 Hes porodice bHLH jest protein koji je kod ljudi kodiran genom HES3 sa hromosoma 1.[5]

Aminokiselinska sekvenca

[uredi | uredi izvor]

Dužina polipeptidnog lanca je 186 aminokiselina, a molekulska težina 19.968 Da.[6]

1020304050
MEKKRRARINVSLEQLKSLLEKHYSHQIRKRKLEKADILELSVKYMRSLQ
NSLQGLWPVPRGAEQPSGFRSCLPGVSQLLRRGDEVGSGLRCPLVPESAA
GSTMDSAGLGQEAPALFRPCTPAVWAPAPAAGGPRSPPPLLLLPESLPGS
SASVPPPQPASSRCAESPGLGLRVWRPWGSPGDDLN

Reference

[uredi | uredi izvor]
  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000173673 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000028946 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: Hes family bHLH transcription factor 3".
  6. ^ "UniProt, Q5TGS1" (jezik: eng.). Pristupljeno 28. 11. 2021.CS1 održavanje: nepoznati jezik (link)

Dopunska literatura

[uredi | uredi izvor]

Vanjski linkovi

[uredi | uredi izvor]

Šablon:Transkripcijski faktori i unutarćelijski receptori

{{bottomLinkPreText}} {{bottomLinkText}}
HES3
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?