For faster navigation, this Iframe is preloading the Wikiwand page for INTS12.

INTS12

INTS12
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1WEV

Identifikatori
AliasiINTS12
Vanjski ID-jeviOMIM: 611355 MGI: 1919043 HomoloGene: 32474 GeneCards: INTS12
Lokacija gena (miš)
Hromosom 3 (miš)
Hrom.Hromosom 3 (miš)[1]
Hromosom 3 (miš)
Genomska lokacija za INTS12
Genomska lokacija za INTS12
Bend3|3 G3Početak132,797,601 bp[1]
Kraj132,816,749 bp[1]
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
vezivanje iona metala
Ćelijska komponenta integrator complex
nukleoplazma
jedro
Biološki proces snRNA processing
snRNA transcription by RNA polymerase II
snRNA 3'-end processing
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001142471
NM_020395

NM_027927

RefSeq (bjelančevina)

NP_001135943
NP_065128
NP_001135943.1
NP_065128.2

NP_082203

Lokacija (UCSC)n/aChr 3: 132.8 – 132.82 Mb
PubMed pretraga[2][3]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Podjedinica 12 integratorskog kompleksa (Int12) znana i kao PHD-prstni protein 22 (PHF22) jest protein koji je kod ljudi kodiran genom INTS12 sa hromosoma 4.[4]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 462 aminokiseline, а molekulska težina 48.808 Da.[5]

1020304050
MAATVNLELDPIFLKALGFLHSKSKDSAEKLKALLDESLARGIDSSYRPS
QKDVEPPKISSTKNISIKQEPKISSSLPSGNNNGKVLTTEKVKKEAEKRP
ADKMKSDITEGVDIPKKPRLEKPETQSSPITVQSSKDLPMADLSSFEETS
ADDFAMEMGLACVVCRQMMVASGNQLVECQECHNLYHRDCHKPQVTDKEA
NDPRLVWYCARCTRQMKRMAQKTQKPPQKPAPAVVSVTPAVKDPLVKKPE
TKLKQETTFLAFKRTEVKTSTVISGNSSSASVSSSVTSGLTGWAAFAAKT
SSAGPSTAKLSSTTQNNTGKPATSSANQKPVGLTGLATSSKGGIGSKIGS
NNSTTPTVPLKPPPPLTLGKTGLSRSVSCDNVSKVGLPSPSSLVPGSSSQ
LSGNGNSGTSGPSGSTTSKTTSESSSSPSASLKGPTSQESQLNAMKRLQM
VKKKAAQKKLKK

Funkcija

INTS12 jest podjedinica integratorskog kompleksa, pridružena C-terminalnom domenu RNK-polimeraze II velike podjedinice (POLR2A) i posreduje 3' preradu malih jedarnih RNK U1 (RNU1) i U2 (RNU2)[4][6]

Modelni organizmi

U istraživanji posljedica delecija gena INT12 upotrebljeni su i modelni organizmi nokaut-miševa linije Ints12

Fenotip Ints12 nokaut-miša
Svojstvo Fenotip
Vijabilnost homozigota Nenormalan
Studija recesivna letalnosti Nenormalan
Plodnost Normalan
Tjelesnsna težina Normalan
Anksioznost otvorenog polja Normalan
Neurološka procjena Normalan
Snaga stiska Normalan
Test vruće ploče Normalan
Dismorfologija Normalan
Indirektna kalorimetrija Normalan
Test tolerancije glukoze Normalan
Slušni odgovor moždanog stabla Normalan
DEXA Normalan
Radiografija Normalan
Tjelesna temperatura Normalan
Morfologija oka Normalan
Klinička hemija Normalan
Hematologija Normalan
Limfociti periferne krvi Normalan
Mikronukleus test Normalan
Težina srca Normalan
Cjelovitost repne epiderme Normalan
Histopatologija kože Normalan
Histopatologija mozga Normalan
Salmonella infekcija Normalan[7]
Citrobacter infekcija Normalan[8]
Svi testovi i alalize su prema:[9][10]

Modelni organizmi bili su iz linije nokaut-miševa zvane Ints12, generirani po programu Međunarodnog konzorcija za nokaut-miševe — visokopropusnog projekta za mutagenezu, generiranje životinjskih modela, na Institutu Wellcome Trust Sanger, zainteresiranim naučnicima[11][12][13]

Dopunska literatura

  • Kalsi G, Kuo PH, Aliev F, et al. (2010). "A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts". Hum. Mol. Genet. 19 (12): 2497–506. doi:10.1093/hmg/ddq112. PMC 2876884. PMID 20332099.
  • Gerhard DS, Wagner L, Feingold EA, et al. (2004). "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)". Genome Res. 14 (10B): 2121–7. doi:10.1101/gr.2596504. PMC 528928. PMID 15489334.
  1. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000028016 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ a b "Entrez Gene: integrator complex subunit 12". Pristupljeno 30. 8. 2011.
  5. ^ "UniProt, Q96CB8" (jezik: engleski). Pristupljeno 28. 10. 2021.
  6. ^ Baillat D, Hakimi MA, et al. (2005). "Integrator, a multiprotein mediator of small nuclear RNA processing, associates with the C-terminal repeat of RNA polymerase II". Cell. 123 (2): 265–76. doi:10.1016/j.cell.2005.08.019. PMID 16239144. S2CID 18069461.
  7. ^ "Salmonella infection data for Mtrf1l". Wellcome Trust Sanger Institute.
  8. ^ "Citrobacter infection data for Mtrf1l". Wellcome Trust Sanger Institute.
  9. ^ Gerdin AK (2010). "The Sanger Mouse Genetics Programme: High throughput characterisation of knockout mice". Acta Ophthalmologica. 88 (S248). doi:10.1111/j.1755-3768.2010.4142.x. S2CID 85911512.
  10. ^ Mouse Resources Portal, Wellcome Trust Sanger Institute.
  11. ^ Skarnes, W. C.; Rosen, B.; West, A. P.; Koutsourakis, M.; Bushell, W.; Iyer, V.; Mujica, A. O.; Thomas, M.; Harrow, J.; Cox, T.; Jackson, D.; Severin, J.; Biggs, P.; Fu, J.; Nefedov, M.; De Jong, P. J.; Stewart, A. F.; Bradley, A. (2011). "A conditional knockout resource for the genome-wide study of mouse gene function". Nature. 474 (7351): 337–342. doi:10.1038/nature10163. PMC 3572410. PMID 21677750.
  12. ^ Dolgin E (juni 2011). "Mouse library set to be knockout". Nature. 474 (7351): 262–3. doi:10.1038/474262a. PMID 21677718.
  13. ^ Collins FS, Rossant J, Wurst W (januar 2007). "A mouse for all reasons". Cell. 128 (1): 9–13. doi:10.1016/j.cell.2006.12.018. PMID 17218247. S2CID 18872015.
{{bottomLinkPreText}} {{bottomLinkText}}
INTS12
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?