For faster navigation, this Iframe is preloading the Wikiwand page for CXCL4.

CXCL4

PF4
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1RHP, 1DN3, 1F9Q, 1F9R, 1F9S, 1PFM, 1PFN, 4R9W, 4R9Y, 4RAU

Identifikatori
AliasiPF4
Vanjski ID-jeviOMIM: 173460 MGI: 1888711 HomoloGene: 87791 GeneCards: PF4
Lokacija gena (čovjek)
Hromosom 4 (čovjek)
Hrom.Hromosom 4 (čovjek)[1]
Hromosom 4 (čovjek)
Genomska lokacija za PF4
Genomska lokacija za PF4
Bend4q13.3Početak73,980,811 bp[1]
Kraj73,982,027 bp[1]
Lokacija gena (miš)
Hromosom 5 (miš)
Hrom.Hromosom 5 (miš)[2]
Hromosom 5 (miš)
Genomska lokacija za PF4
Genomska lokacija za PF4
Bend5|5 E1Početak90,920,294 bp[2]
Kraj90,921,242 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija cytokine activity
heparin binding
CXCR3 chemokine receptor binding
chemokine activity
GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta extracellular region
platelet alpha granule lumen
Vanćelijsko
citoplazma
collagen-containing extracellular matrix
Biološki proces cytokine-mediated signaling pathway
chemokine-mediated signaling pathway
positive regulation of macrophage differentiation
platelet degranulation
negative regulation of megakaryocyte differentiation
positive regulation of cAMP-mediated signaling
negative regulation of MHC class II biosynthetic process
leukocyte chemotaxis
Hemotaksija
response to lipopolysaccharide
positive regulation of macrophage derived foam cell differentiation
GO:1901313 positive regulation of gene expression
regulation of cell population proliferation
GO:0046730, GO:0046737, GO:0046738, GO:0046736 Imuni odgovor
positive regulation of tumor necrosis factor production
negative regulation of angiogenesis
negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
inflammatory response
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
negative regulation of cytolysis
platelet activation
defense response
positive regulation of neutrophil chemotaxis
antimicrobial humoral immune response mediated by antimicrobial peptide
regulation of megakaryocyte differentiation
regulation of signaling receptor activity
G protein-coupled receptor signaling pathway
adenylate cyclase-activating G protein-coupled receptor signaling pathway
neutrophil chemotaxis
cellular response to lipopolysaccharide
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_002619
NM_001363352

NM_019932

RefSeq (bjelančevina)

NP_002610
NP_001350281

NP_064316

Lokacija (UCSC)Chr 4: 73.98 – 73.98 MbChr 5: 90.92 – 90.92 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Trombocitni faktor 4 (PF4) jest mali hemokin koji je kod ljudi kodiran genom CXCL4 sa hromosoma 4. Pripada porodici hemokina CXC koja je poznata i kao hemokinski ligand 4 (C-X-C motiv). Ovaj se hemokin oslobađa iz alfa-granule aktiviranih trombocita tokom njihove agregacije i podstiče koagulaciju krvi ublažavanjem učinaka molekula sličnih heparinu . Zbog ovih dejstava, predviđa se da ima ulogu u zarastanju rana i upalama.[5] Obično se nalazi u kompleksu s proteoglikanom.

Aminokiselinska sekvenca

[uredi | uredi izvor]

Dužina polipeptidnog lanca je101 aminokiselina, а molekulska težina 10.845 Da.[6].

1020304050
MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQV
RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLE
S

Funkcija

[uredi | uredi izvor]

Trombocitni faktor-4 je protein od 70 aminokiselina koji se oslobađa iz alfa granula aktiviranih trombocita i veže se s visokim afinitetom za heparin. Čini se da je njegova glavna fiziološka uloga neutraliziranje molekula sličnih heparinu na endotelnoj površini krvnih dugova, čime se inhibira lokalna antitrombinska aktivnost i podstiče koagulacija. Kao snažan hemoatraktant za neutrofile i fibroblaste, PF4 vjerovatno ima ulogu u upali i popravci rana.[5][7]

PF4 je ima hemotaksijsku aktuvnost aa neutrofil , fibroblast e i monocit, te stupa u interakciju s prerađenim varijantama transkripta receptora hemokina CXCR3, poznatim kao CXCR3-B .[8]

Klinički značaj

[uredi | uredi izvor]

Kompleks heparin: PF4 je antigen u heparin induciranoj trombocitopeniji, idiosinkratskoj autoimunskoj reakciji na primjenu antikoagulansa heparina.[9] PF4 autoantitijela također su pronađeni kod pacijenata sa trombozom i karakteristikama koje liče na HIT, ali bez prethodne primjene heparina.[10] Antitijela protiv PF4 implicirana su u slučajevima tromboze i trombocitopenije nakon vakcinacije Oxford–AstraZeneca ili Janssen COVID-19 vakcinama.[11][12] Ovaj fenomen nazvan je embolija i imunotrombozna trombocitopenija izazvana vakcinom (VITT).[13]

Povećava se kod pacijenata sa sistemskom sklerozom koji također imaju i intersticijsku plućnu bolest.[14]

Faktor ljudskih trombocita 4 ubija malarijske parazite unutar eritrocita, selektivnom razlaganjem njihove probavne vakuole.[15]

Također pogledajte

[uredi | uredi izvor]

Reference

[uredi | uredi izvor]
  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000163737 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000029373 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b Eisman R, Surrey S, Ramachandran B, Schwartz E, Poncz M (juli 1990). "Structural and functional comparison of the genes for human platelet factor 4 and PF4alt". Blood. 76 (2): 336–44. doi:10.1182/blood.V76.2.336.336. PMID 1695112.
  6. ^ "UniProt, P02776" (jezik: engleski). Pristupljeno 23. 10. 2021.
  7. ^ "Entrez Gene: PF4 platelet factor 4 (chemokine (C-X-C motif) ligand 4)".
  8. ^ Lasagni L, Francalanci M, Annunziato F, Lazzeri E, Giannini S, Cosmi L, et al. (juni 2003). "An alternatively spliced variant of CXCR3 mediates the inhibition of endothelial cell growth induced by IP-10, Mig, and I-TAC, and acts as functional receptor for platelet factor 4". The Journal of Experimental Medicine. 197 (11): 1537–49. doi:10.1084/jem.20021897. PMC 2193908. PMID 12782716.
  9. ^ Warkentin TE (mart 2007). "Drug-induced immune-mediated thrombocytopenia--from purpura to thrombosis". The New England Journal of Medicine. 356 (9): 891–3. doi:10.1056/NEJMp068309. PMID 17329695.
  10. ^ Warkentin TE, Makris M, Jay RM, Kelton JG (juli 2008). "A spontaneous prothrombotic disorder resembling heparin-induced thrombocytopenia". The American Journal of Medicine. 121 (7): 632–6. doi:10.1016/j.amjmed.2008.03.012. PMID 18589060.
  11. ^ Schultz NH, Sørvoll IH, Michelsen AE, Munthe LA, Lund-Johansen F, Ahlen MT, et al. (april 2021). "Thrombosis and Thrombocytopenia after ChAdOx1 nCoV-19 Vaccination". The New England Journal of Medicine. 384 (22): 2124–2130. doi:10.1056/NEJMoa2104882. PMC 8112568 Provjerite vrijednost parametra |pmc= (pomoć). PMID 33835768.
  12. ^ Greinacher A, Thiele T, Warkentin TE, Weisser K, Kyrle PA, Eichinger S (april 2021). "Thrombotic Thrombocytopenia after ChAdOx1 nCov-19 Vaccination". The New England Journal of Medicine. 384 (22): 2092–2101. doi:10.1056/NEJMoa2104840. PMC 8095372. PMID 33835769.
  13. ^ Arepally GM, Ortel TL (juni 2021). "Vaccine-Induced Immune Thrombotic Thrombocytopenia (VITT): What We Know and Don't Know". Blood. doi:10.1182/blood.2021012152. PMC 8172307 Provjerite vrijednost parametra |pmc= (pomoć). PMID 34061166 Provjerite vrijednost parametra |pmid= (pomoć).
  14. ^ Volkmann ER, Tashkin DP, Roth MD, Clements PJ, Khanna D, Furst DE, et al. (decembar 2016). "Changes in plasma CXCL4 levels are associated with improvements in lung function in patients receiving immunosuppressive therapy for systemic sclerosis-related interstitial lung disease". Arthritis Research & Therapy. 18 (1): 305. doi:10.1186/s13075-016-1203-y. PMC 5203703. PMID 28038680.
  15. ^ Love MS, Millholland MG, Mishra S, Kulkarni S, Freeman KB, Pan W, et al. (decembar 2012). "Platelet factor 4 activity against P. falciparum and its translation to nonpeptidic mimics as antimalarials". Cell Host & Microbe. 12 (6): 815–23. doi:10.1016/j.chom.2012.10.017. PMC 3638032. PMID 23245326.

Dopunska literstura

[uredi | uredi izvor]

Vanjski linkovi

[uredi | uredi izvor]

Šablon:Proteoglikani

Ovaj članak uključuje tekst iz Nacionalne medicinske biblioteke Sjedinjenih Država, koji je u javnom vlasništvu.

{{bottomLinkPreText}} {{bottomLinkText}}
CXCL4
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?