For faster navigation, this Iframe is preloading the Wikiwand page for TRAM2.

TRAM2

TRAM2
Identifikatori
AliasiTRAM2
Vanjski ID-jeviOMIM: 608485 MGI: 1924817 HomoloGene: 8183 GeneCards: TRAM2
Lokacija gena (čovjek)
Hromosom 6 (čovjek)
Hrom.Hromosom 6 (čovjek)[1]
Hromosom 6 (čovjek)
Genomska lokacija za TRAM2
Genomska lokacija za TRAM2
Bend6p12.2Početak52,497,408 bp[1]
Kraj52,577,060 bp[1]
Lokacija gena (miš)
Hromosom 1 (miš)
Hrom.Hromosom 1 (miš)[2]
Hromosom 1 (miš)
Genomska lokacija za TRAM2
Genomska lokacija za TRAM2
Bend1|1 A4Početak21,066,523 bp[2]
Kraj21,149,453 bp[2]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta membrana
integral component of membrane
rough endoplasmic reticulum
Biološki proces protein transport
collagen biosynthetic process
protein insertion into ER membrane
SRP-dependent cotranslational protein targeting to membrane, translocation
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_012288

NM_177409

RefSeq (bjelančevina)

NP_036420

NP_803128

Lokacija (UCSC)Chr 6: 52.5 – 52.58 MbChr 1: 21.07 – 21.15 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Membranski protein 2 na translokacijskom lancu jest protein koji je kod ljudi kodiran genom TRAM2.[5][6][7]

Aminokiselinska sekvenca

[uredi | uredi izvor]

Dužina polipeptidnog lanca je 370 aminokiselina, а molekulska težina 43.328 Da.[8]

1020304050
MAFRRRTKSYPLFSQEFVIHNHADIGFCLVLCVLIGLMFEVTAKTAFLFI
LPQYNISVPTADSETVHYHYGPKDLVTILFYIFITIILHAVVQEYILDKI
SKRLHLSKVKHSKFNESGQLVVFHFTSVIWCFYVVVTEGYLTNPRSLWED
YPHVHLPFQVKFFYLCQLAYWLHALPELYFQKVRKEEIPRQLQYICLYLV
HIAGAYLLNLSRLGLILLLLQYSTEFLFHTARLFYFADENNEKLFSAWAA
VFGVTRLFILTLAVLAIGFGLARMENQAFDPEKGNFNTLFCRLCVLLLVC
AAQAWLMWRFIHSQLRHWREYWNEQSAKRRVPATPRLPARLIKRESGYHE
NGVVKAENGTSPRTKKLKSP

Funkcija

[uredi | uredi izvor]

TRAM2 je komponenta translokona, zatvorenog makromolekulskog kanala koji kontrolira posttranslacijsku obradu nastajućih sekretornih i membranskih proteina na membrani endoplazmatskog retikuluma (ER).[7]

Reference

[uredi | uredi izvor]
  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000065308 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000041779 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Nomura N, Nagase T, Miyajima N, Sazuka T, Tanaka A, Sato S, Seki N, Kawarabayasi Y, Ishikawa K, Tabata S (Dec 1995). "Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1". DNA Res. 1 (5): 223–9. doi:10.1093/dnares/1.5.223. PMID 7584044.
  6. ^ Onuchic LF, Mrug M, Lakings AL, Muecher G, Becker J, Zerres K, Avner ED, Dixit M, Somlo S, Germino GG, Guay-Woodford LM (Jan 2000). "Genomic organization of the KIAA0057 gene that encodes a TRAM-like protein and its exclusion as a polycystic kidney and hepatic disease 1 (PKHD1) candidate gene". Mamm Genome. 10 (12): 1175–8. doi:10.1007/s003359901186. PMID 10594243. S2CID 11705244.
  7. ^ a b "Entrez Gene: TRAM2 translocation associated membrane protein 2".
  8. ^ "UniProt, Q15035" (jezik: engleski). Pristupljeno 5. 10. 2021.

Dopunska literatura

[uredi | uredi izvor]
{{bottomLinkPreText}} {{bottomLinkText}}
TRAM2
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?