For faster navigation, this Iframe is preloading the Wikiwand page for TM4SF1.

TM4SF1

TM4SF1
Identifikatori
AliasiTM4SF1
Vanjski ID-jeviOMIM: 191155 MGI: 104678 HomoloGene: 7409 GeneCards: TM4SF1
Lokacija gena (čovjek)
Hromosom 3 (čovjek)
Hrom.Hromosom 3 (čovjek)[1]
Hromosom 3 (čovjek)
Genomska lokacija za TM4SF1
Genomska lokacija za TM4SF1
Bend3q25.1Početak149,369,022 bp[1]
Kraj149,377,692 bp[1]
Lokacija gena (miš)
Hromosom 3 (miš)
Hrom.Hromosom 3 (miš)[2]
Hromosom 3 (miš)
Genomska lokacija za TM4SF1
Genomska lokacija za TM4SF1
Bend3|3 DPočetak57,193,032 bp[2]
Kraj57,209,409 bp[2]
Obrazac RNK ekspresije




Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
molekularna funkcija
Ćelijska komponenta integral component of plasma membrane
membrana
integral component of membrane
Biološki proces GO:0022610 biološki proces
blastocyst formation
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_014220

NM_008536
NM_001355130

RefSeq (bjelančevina)

NP_055035

NP_032562
NP_001342059

Lokacija (UCSC)Chr 3: 149.37 – 149.38 MbChr 3: 57.19 – 57.21 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Član 1 porodice 4 L6 transmembranskih proteina jest protein koji je kod ljudi kodiran genom TM4SF1 sa hromosoma 3.[5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 202 aminokiseline, а molekulska težina 21.632 Da.[7]

1020304050
MCYGKCARCIGHSLVGLALLCIAANILLYFPNGETKYASENHLSRFVWFF
SGIVGGGLLMLLPAFVFIGLEQDDCCGCCGHENCGKRCAMLSSVLAALIG
IAGSGYCVIVAALGLAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECT
EPKHIVEWNVSLFSILLALGGIEFILCLIQVINGVLGGICGFCCSHQQQY
DC

Funkcija

Protein kodiran ovim genom je član natporodice 4 transmembranskih proteina, poznate i kao porodica tetraspanina . Većina ovih članova su proteini na površini ćelije koje karakteriše prisustvo četiri hidrofobna domena. Proteini posreduju u događajima transdukcije signala koji imaju ulogu u regulaciji razvoja, aktivacije, rasta i pokretljivosti ćelija. Ovaj kodirani protein je antigen ćelijske površine i visoko je eksprimiran u različitim karcinomima.[6]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000169908 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000027800 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Marken JS, Schieven GL, Hellström I, Hellström KE, Aruffo A (Apr 1992). "Cloning and expression of the tumor-associated antigen L6". Proceedings of the National Academy of Sciences of the United States of America. 89 (8): 3503–7. doi:10.1073/pnas.89.8.3503. PMC 48896. PMID 1565644.
  6. ^ a b "Entrez Gene: TM4SF1 transmembrane 4 L six family member 1".
  7. ^ "UniProt, P30408" (jezik: engleski). Pristupljeno 2. 11. 2021.

Dopunska literatura

{{bottomLinkPreText}} {{bottomLinkText}}
TM4SF1
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?