For faster navigation, this Iframe is preloading the Wikiwand page for SERP1.

SERP1

SERP1
Identifikatori
AliasiSERP1
Vanjski ID-jeviOMIM: 617674 MGI: 92638 HomoloGene: 8691 GeneCards: SERP1
Lokacija gena (čovjek)
Hromosom 3 (čovjek)
Hrom.Hromosom 3 (čovjek)[1]
Hromosom 3 (čovjek)
Genomska lokacija za SERP1
Genomska lokacija za SERP1
Bend3q25.1Početak150,541,998 bp[1]
Kraj150,603,228 bp[1]
Lokacija gena (miš)
Hromosom 3 (miš)
Hrom.Hromosom 3 (miš)[2]
Hromosom 3 (miš)
Genomska lokacija za SERP1
Genomska lokacija za SERP1
Bend3 D|3 28.58 cMPočetak58,427,238 bp[2]
Kraj58,433,313 bp[2]
Obrazac RNK ekspresije




Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta integral component of membrane
citosol
ribozom
endoplasmic reticulum membrane
membrana
Endoplazmatski retikulum
cytoplasmic microtubule
Biološki proces skeletal system development
muscle organ morphogenesis
positive regulation of organ growth
post-embryonic development
positive regulation of translation
IRE1-mediated unfolded protein response
positive regulation of growth hormone secretion
glucose metabolic process
multicellular organism aging
protein transport
plasma membrane organization
positive regulation of insulin secretion
endoplasmic reticulum unfolded protein response
GO:0033578, GO:0033577, GO:0033575, GO:0033576 protein glycosylation
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_014445

NM_030685

RefSeq (bjelančevina)

NP_055260

NP_109610

Lokacija (UCSC)Chr 3: 150.54 – 150.6 MbChr 3: 58.43 – 58.43 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Stresno-pridruženi endoplazmatskoretikulumski protein 1 jest protein koji je kod ljudi kodiran genom SERP1 sa hromosoma 3.[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 66 aminokiselina, а molekulska težina 7.374 Da.[8]

1020304050
MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVV
CGSAIFQIIQSIRMGM

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000120742 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000027808 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Yamaguchi A, Hori O, Stern DM, Hartmann E, Ogawa S, Tohyama M (Jan 2000). "Stress-associated endoplasmic reticulum protein 1 (SERP1)/Ribosome-associated membrane protein 4 (RAMP4) stabilizes membrane proteins during stress and facilitates subsequent glycosylation". J Cell Biol. 147 (6): 1195–204. doi:10.1083/jcb.147.6.1195. PMC 2168098. PMID 10601334.
  6. ^ Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A (Mar 2001). "Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs". Genome Res. 11 (3): 422–35. doi:10.1101/gr.GR1547R. PMC 311072. PMID 11230166.
  7. ^ "Entrez Gene: SERP1 stress-associated endoplasmic reticulum protein 1".
  8. ^ "UniProt, Q9Y6X1" (jezik: engleski). Pristupljeno 8. 11. 2021.

Dopunska kiteratura

{{bottomLinkPreText}} {{bottomLinkText}}
SERP1
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?