For faster navigation, this Iframe is preloading the Wikiwand page for SELT.

SELT

SELT
Identifikatori
AliasiSELENOT
Vanjski ID-jeviOMIM: 607912 MGI: 1916477 HomoloGene: 32304 GeneCards: SELENOT
Lokacija gena (čovjek)
Hromosom 3 (čovjek)
Hrom.Hromosom 3 (čovjek)[1]
Hromosom 3 (čovjek)
Genomska lokacija za SELT
Genomska lokacija za SELT
Bend3q25.1Početak150,602,875 bp[1]
Kraj150,630,436 bp[1]
Lokacija gena (miš)
Hromosom 3 (miš)
Hrom.Hromosom 3 (miš)[2]
Hromosom 3 (miš)
Genomska lokacija za SELT
Genomska lokacija za SELT
Bend3|3 DPočetak58,484,057 bp[2]
Kraj58,500,554 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija selenium binding
thioredoxin-disulfide reductase activity
oxidoreductase activity
Ćelijska komponenta Endoplazmatski retikulum
endoplasmic reticulum membrane
membrana
integral component of membrane
Biološki proces selenocysteine incorporation
positive regulation of cytosolic calcium ion concentration
positive regulation of growth hormone secretion
cellular oxidant detoxification
response to glucose
pancreas development
insulin secretion involved in cellular response to glucose stimulus
glucose homeostasis
cell redox homeostasis
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_016275

NM_001040396
NM_026997

RefSeq (bjelančevina)

NP_057359

NP_001035486

Lokacija (UCSC)Chr 3: 150.6 – 150.63 MbChr 3: 58.48 – 58.5 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Selenoprotein T, znan i kao SELT, jest protein koji je kod ljudi kodiran genom SELT sa hromosoma 3.[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 195 aminokiselina, а molekulska težina 22.324 Da.[8]

1020304050
MRLLLLLLVAASAMVRSEASANLGGVPSKRLKMQYATGPLLKFQICVSG
YRRVFEEYMRVISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLI
IVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFE
ITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS

Gen

Selenocistein je kodiran UGA kodonom koji normalno signalizira završetak translacije. 3' UTR gena selenoproteina ima zajedničku strukturu petlje i drškre, sekvencu insercije sek (SECIS), koja je neophodna za prepoznavanje UGA kao Sec kodona, a ne kao stop signala.[7]

Struktura proteina

Selenoprotein T ima selenocisteinske (Sec) ostatke na aktivnom mjestu.

Također pogledajte

  • Selenoprotein

References

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000198843 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000075700 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Kryukov GV, Kryukov VM, Gladyshev VN (novembar 1999). "New mammalian selenocysteine-containing proteins identified with an algorithm that searches for selenocysteine insertion sequence elements". J. Biol. Chem. 274 (48): 33888–97. doi:10.1074/jbc.274.48.33888. PMID 10567350.
  6. ^ Kryukov GV, Castellano S, Novoselov SV, Lobanov AV, Zehtab O, Guigó R, Gladyshev VN (maj 2003). "Characterization of mammalian selenoproteomes". Science. 300 (5624): 1439–43. Bibcode:2003Sci...300.1439K. doi:10.1126/science.1083516. PMID 12775843. S2CID 10363908.
  7. ^ a b "Entrez Gene: SELT selenoprotein T".
  8. ^ "UniProt, P62341" (jezik: engleski). Pristupljeno 9. 11. 2021.

Dopunska literatura

{{bottomLinkPreText}} {{bottomLinkText}}
SELT
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?