For faster navigation, this Iframe is preloading the Wikiwand page for PKIA.

PKIA

PKIA
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1CMK, 1JLU, 1Q8T, 1XH4, 1XH5, 1XH6, 1XH7, 1XH8, 1XH9, 1XHA, 1YDR, 2C1A, 2C1B, 2F7E, 2GNI, 2JDS, 2JDT, 2JDV, 2L1L, 2UVY, 2UVZ, 2UW0, 2UW3, 2UW4, 2UW5, 2UW6, 2UW7, 2UW8, 2VNW, 2VNY, 2VO0, 2VO3, 2VO6, 2VO7, 3AMA, 3AMB, 3L9L, 3L9M, 3L9N, 3MVJ, 3NX8, 3OOG, 3OVV, 3OWP, 3OXT, 3P0M, 3POO, 3VQH, 3WYG, 4AXA, 4IAC, 4IAD, 4IAF, 4IAI, 4IAK, 4IAY, 4IAZ, 4IB0, 4IB1, 4IB3, 4IE9, 4IJ9, 4O21, 4O22, 4WB5, 4WB6, 4WB7, 4WB8, 4Z83, 4Z84, 5DH9, 1Q61, 3X2U, 3X2W, 1Q62, 3X2V, 4UJA, 4UJ9, 4UJB, 4UJ2, 4UJ1

Identifikatori
AliasiPKIA
Vanjski ID-jeviOMIM: 606059 MGI: 104747 HomoloGene: 7473 GeneCards: PKIA
Lokacija gena (čovjek)
Hromosom 8 (čovjek)
Hrom.Hromosom 8 (čovjek)[1]
Hromosom 8 (čovjek)
Genomska lokacija za PKIA
Genomska lokacija za PKIA
Bend8q21.13Početak78,516,340 bp[1]
Kraj78,605,267 bp[1]
Lokacija gena (miš)
Hromosom 3 (miš)
Hrom.Hromosom 3 (miš)[2]
Hromosom 3 (miš)
Genomska lokacija za PKIA
Genomska lokacija za PKIA
Bend3|3 A1Početak7,431,729 bp[2]
Kraj7,510,426 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija protein kinase inhibitor activity
GO:0001948, GO:0016582 vezivanje za proteine
cAMP-dependent protein kinase inhibitor activity
protein kinase A catalytic subunit binding
kinase activity
Ćelijska komponenta citoplazma
jedro
Biološki proces regulation of G2/M transition of mitotic cell cycle
GO:0048553 negative regulation of catalytic activity
GO:1901227 negative regulation of transcription by RNA polymerase II
negative regulation of cAMP-dependent protein kinase activity
negative regulation of protein kinase activity
negative regulation of protein import into nucleus
negative regulation of protein serine/threonine kinase activity
Fosforilacija
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_181839
NM_006823

NM_008862

RefSeq (bjelančevina)

NP_006814
NP_862822
NP_006814.1
NP_862822.1

NP_032888

Lokacija (UCSC)Chr 8: 78.52 – 78.61 MbChr 3: 7.43 – 7.51 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

cAMP-ovisni inhibitor alfa protein-kinaze je protein koji je kod ljudi kodiran genom PKIA.[5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 76 aminokiselina, а molekulska težina 7.989 Da.[7]

1020304050
MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKT
EGEEDAQRSSTEQSGEAQGEAAKSES

Funkcija

Protein kodiran ovim genom član je porodice inhibitora protein kinaze (PKA) ovisne o cAMP-u. Pokazalo se da ovaj protein stupa u interakciju i inhibira aktivnosti katalitskih podjedinica C alfa i C beta PKA. Prijavljene su Alternativno prerađene varijante transkripta, koje kodiraju isti protein.[6]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000171033 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000027499 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Olsen SR, Uhler MD (Feb 1992). "Inhibition of protein kinase-A by overexpression of the cloned human protein kinase inhibitor". Mol Endocrinol. 5 (9): 1246–1256. doi:10.1210/mend-5-9-1246. PMID 1770951.
  6. ^ a b "Entrez Gene: PKIA protein kinase (cAMP-dependent, catalytic) inhibitor alpha".
  7. ^ "UniProt, P61925" (jezik: engleski). Pristupljeno 20. 9. 2021.

Dopunska literatura

{{bottomLinkPreText}} {{bottomLinkText}}
PKIA
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?