For faster navigation, this Iframe is preloading the Wikiwand page for IMP3.

IMP3

IMP3
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2CQJ

Identifikatori
AliasiIMP3
Vanjski ID-jeviOMIM: 612980 MGI: 1916119 HomoloGene: 6120 GeneCards: IMP3
Lokacija gena (čovjek)
Hromosom 15 (čovjek)
Hrom.Hromosom 15 (čovjek)[1]
Hromosom 15 (čovjek)
Genomska lokacija za IMP3
Genomska lokacija za IMP3
Bend15q24.2Početak75,639,085 bp[1]
Kraj75,648,706 bp[1]
Lokacija gena (miš)
Hromosom 9 (miš)
Hrom.Hromosom 9 (miš)[2]
Hromosom 9 (miš)
Genomska lokacija za IMP3
Genomska lokacija za IMP3
Bend9|9 BPočetak56,844,759 bp[2]
Kraj56,845,682 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija structural constituent of ribosome
rRNA binding
GO:0001948, GO:0016582 vezivanje za proteine
snoRNA binding
vezivanje sa RNK
Ćelijska komponenta small ribosomal subunit
small-subunit processome
Mpp10 complex
Jedarce
intracellular anatomical structure
jedro
nukleoplazma
preribosome
Biološki proces positive regulation of translational fidelity
ribosome biogenesis
rRNA processing
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_018285

NM_133976

RefSeq (bjelančevina)

NP_060755

NP_598737

Lokacija (UCSC)Chr 15: 75.64 – 75.65 MbChr 9: 56.84 – 56.85 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Mali U3 jedarcetov ribonukleoproteinski protein IMP3 je protein koji je kod ljudi kodiran genom IMP3.[5][6][7]

Aminokiselinska sekvenca

[uredi | uredi izvor]

Dužina polipeptidnog lanca je 184 aminokiseline, a molekulska težina 21.850 Da.[8]

1020304050
MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQ
LSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDF
VTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLV
TRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA
Simboli

Funkcija

[uredi | uredi izvor]

Ovaj gen kodira ljudski homolog kvaščevog proteina Imp3. Protein se lokalizira na jedarcetu i stupa u interakciju sa kompleksom U3 snoRNP. Protein sadrži S4 domen.[7]

Reference

[uredi | uredi izvor]
  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000177971 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000032288 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Kenmochi N, Suzuki T, Uechi T, Magoori M, Kuniba M, Higa S, Watanabe K, Tanaka T (septembar 2001). "The human mitochondrial ribosomal protein genes: mapping of 54 genes to the chromosomes and implications for human disorders". Genomics. 77 (1–2): 65–70. doi:10.1006/geno.2001.6622. PMID 11543634.
  6. ^ Granneman S, Gallagher JE, Vogelzangs J, Horstman W, van Venrooij WJ, Baserga SJ, Pruijn GJ (april 2003). "The human Imp3 and Imp4 proteins form a ternary complex with hMpp10, which only interacts with the U3 snoRNA in 60-80S ribonucleoprotein complexes". Nucleic Acids Research. 31 (7): 1877–87. doi:10.1093/nar/gkg300. PMC 152815. PMID 12655004.
  7. ^ a b "Entrez Gene: IMP3 IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast)".
  8. ^ "UniProt, Q9NV31". Pristupljeno 15. 7. 2021.

Dopunska literatura

[uredi | uredi izvor]

Vanjski linkovi

[uredi | uredi izvor]
{{bottomLinkPreText}} {{bottomLinkText}}
IMP3
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?