For faster navigation, this Iframe is preloading the Wikiwand page for Glipikan 5.

Glipikan 5

Glipikan 5
Identifikatori
AliasiGPC5
Vanjski ID-jeviOMIM: 602446 MGI: 1194894 HomoloGene: 3285 GeneCards: GPC5
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za Glipikan 5
Genomska lokacija za Glipikan 5
Bend13q31.3Početak91,398,621 bp[1]
Kraj92,873,682 bp[1]
Lokacija gena (miš)
Hromosom 14 (miš)
Hrom.Hromosom 14 (miš)[2]
Hromosom 14 (miš)
Genomska lokacija za Glipikan 5
Genomska lokacija za Glipikan 5
Bend14|14 E4Početak115,329,647 bp[2]
Kraj116,762,591 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija heparan sulfate proteoglycan binding
Ćelijska komponenta integral component of plasma membrane
extracellular region
membrana
anchored component of membrane
Golgi lumen
ćelijska membrana
lysosomal lumen
Vanćelijsko
anchored component of plasma membrane
integral component of membrane
collagen-containing extracellular matrix
cell surface
Biološki proces glycosaminoglycan biosynthetic process
retinoid metabolic process
glycosaminoglycan catabolic process
regulation of signal transduction
Ćelijska migracija
positive regulation of canonical Wnt signaling pathway
regulation of protein localization to membrane
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_004466

NM_175500

RefSeq (bjelančevina)

NP_004457

NP_780709

Lokacija (UCSC)Chr 13: 91.4 – 92.87 MbChr 14: 115.33 – 116.76 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Glipikan-5 je protein koji je kod ljudi kodiran genom GPC5, koji se nalazio na hromosomu 13, sekvenca 13q31.3, raspon baznih parova 91,398.621 – 92,873,682 bp.[5][6]

Heparan sulfatni proteoglikani na površini ćelije, sastoje se od proteinskog jezgra povezanog s membranom, supstituirane s promjenjivim brojem lanaca heparan-sulfata. Članovi glipikano povezane proteoglikanske porodice membrana (GRIPS) sadrže jezgreni protein usidren u citoplazmatsku membranu, preko veze glikozil-fosfatidilinositola. Ovi proteini mogu imati ulogu u kontroli diobe ćelija i regulaciji rasta.[6]

Aminokiselinska sekvenca

[uredi | uredi izvor]

Dužina polipeptidnog lanca je 572 aminokiseline, a molekulska težina 63.707 Da.[7]

1020304050
MDAQTWPVGFRCLLLLALVGSARSEGVQTCEEVRKLFQWRLLGAVRGLPD
SPRAGPDLQVCISKKPTCCTRKMEERYQIAARQDMQQFLQTSSSTLKFLI
SRNAAAFQETLETLIKQAENYTSILFCSTYRNMALEAAASVQEFFTDVGL
YLFGADVNPEEFVNRFFDSLFPLVYNHLINPGVTDSSLEYSECIRMARRD
VSPFGNIPQRVMGQMGRSLLPSRTFLQALNLGIEVINTTDYLHFSKECSR
ALLKMQYCPHCQGLALTKPCMGYCLNVMRGCLAHMAELNPHWHAYIRSLE
ELSDAMHGTYDIGHVLLNFHLLVNDAVLQAHLNGQKLLEQVNRICGRPVR
TPTQSPRCSFDQSKEKHGMKTTTRNSEETLANRRKEFINSLRLYRSFYGG
LADQLCANELAAADGLPCWNGEDIVKSYTQRVVGNGIKAQSGNPEVKVKG
IDPVINQIIDKLKHVVQLLQGRSPKPDKWELLQLGSGGGMVEQVSGDCDD
EDGCGGSGSGEVKRTLKITDWMPDDMNFSDVKQIHQTDTGSTLDTTGAGC
AVATESMTFTLISVVMLLPGIW
Simboli

Također pogledajte

[uredi | uredi izvor]

Reference

[uredi | uredi izvor]
  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000179399 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000022112 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Veugelers M, Vermeesch J, Reekmans G, Steinfeld R, Marynen P, David G (Jun 1997). "Characterization of glypican-5 and chromosomal localization of human GPC5, a new member of the glypican gene family". Genomics. 40 (1): 24–30. doi:10.1006/geno.1996.4518. PMID 9070915.
  6. ^ a b "Entrez Gene: GPC5 glypican 5".
  7. ^ "UniProt, P78333". Pristupljeno 11. 9. 2017.

Dopunska literatura

[uredi | uredi izvor]
{{bottomLinkPreText}} {{bottomLinkText}}
Glipikan 5
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?