For faster navigation, this Iframe is preloading the Wikiwand page for FRAT2.

FRAT2

FRAT2
Identifikatori
AliasiFRAT2
Vanjski ID-jeviOMIM: 605006 MGI: 2673967 HomoloGene: 8095 GeneCards: FRAT2
Lokacija gena (čovjek)
Hromosom 10 (čovjek)
Hrom.Hromosom 10 (čovjek)[1]
Hromosom 10 (čovjek)
Genomska lokacija za FRAT2
Genomska lokacija za FRAT2
Bend10q24.1Početak97,332,497 bp[1]
Kraj97,334,729 bp[1]
Lokacija gena (miš)
Hromosom 19 (miš)
Hrom.Hromosom 19 (miš)[2]
Hromosom 19 (miš)
Genomska lokacija za FRAT2
Genomska lokacija za FRAT2
Bend19 C3|19 35.33 cMPočetak41,834,411 bp[2]
Kraj41,836,571 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija molekularna funkcija
Ćelijska komponenta citosol
ćelijska komponenta
citoplazma
Biološki proces multicellular organism development
Ćelijska proliferacija
Wnt-signalni put
beta-catenin destruction complex disassembly
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_012083

NM_177603

RefSeq (bjelančevina)

NP_036215

NP_808271

Lokacija (UCSC)Chr 10: 97.33 – 97.33 MbChr 19: 41.83 – 41.84 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

GSK-3-vezujući protein FRAT2 je protein koji je kod ljudi kodiran genom FRAT2.[5][6][7]

Protein kodiran ovim bezintronskim genom pripada porodici proteina koji se vezuju za GSK-3. Studije pokazuju da ovaj protein ima ulogu pozitivnog regulatora WNT-signalnog puta. Može se povećati u progresiji tumora.[7]

Aminokiselinska sekvenca

[uredi | uredi izvor]

Dužina polipeptidnog lanca je 233 aminokiseline, а molekulska težina 24.051 Da.[8]

1020304050
MPCRREEEEEAGEEAEGEEEEDDSFLLLQQSVTLGSSGEVDRLVAQIGET
LQLDAAQDSPASPCAPPGVPLRAPGPLAAAVPADKARPPAVPLLLPPASA
ETVGPAPSGALRCALGDRGRVRGRAAPYCVAEVAAGPSALPGPCRRGWLR
DAVTSRRLQQRRWTQAGARAGDDDPHRLLQQLVLSGNLIKEAVRRLQRAV
AAVAATGPASAPGPGGGRSGPDRIALQPSGSLL

Reference

[uredi | uredi izvor]
  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000181274 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000047604 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Yost C, Farr GH 3rd, Pierce SB, Ferkey DM, Chen MM, Kimelman D (Jul 1998). "GBP, an inhibitor of GSK-3, is implicated in Xenopus development and oncogenesis". Cell. 93 (6): 1031–41. doi:10.1016/S0092-8674(00)81208-8. PMID 9635432. S2CID 17951152.
  6. ^ Saitoh T, Moriwaki J, Koike J, Takagi A, Miwa T, Shiokawa K, Katoh M (Mar 2001). "Molecular cloning and characterization of FRAT2, encoding a positive regulator of the WNT signaling pathway". Biochem Biophys Res Commun. 281 (3): 815–20. doi:10.1006/bbrc.2001.4421. PMID 11237732.
  7. ^ a b "Entrez Gene: FRAT2 frequently rearranged in advanced T-cell lymphomas 2".
  8. ^ "UniProt, O75474". Pristupljeno 2. 9. 2021.

Dopunska literatura

[uredi | uredi izvor]
{{bottomLinkPreText}} {{bottomLinkText}}
FRAT2
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?