For faster navigation, this Iframe is preloading the Wikiwand page for OMP.

OMP

Матеріал з Вікіпедії — вільної енциклопедії.

OMP
Ідентифікатори
Символи OMP, olfactory marker protein
Зовнішні ІД OMIM: 164340 MGI: 97436 HomoloGene: 36195 GeneCards: OMP
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006189
NM_011010
RefSeq (білок)
NP_006180
NP_035140
Локус (UCSC) Хр. 11: 77.1 – 77.1 Mb Хр. 7: 97.79 – 97.79 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

OMP (англ. Olfactory marker protein) – білок, який кодується однойменним геном, розташованим у людей на 11-й хромосомі.[3] Довжина поліпептидного ланцюга білка становить 163 амінокислот, а молекулярна маса — 18 937[4].

Послідовність амінокислот
1020304050
MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAE
SVYRLNFTQQQRLQFERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLL
DPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVE
PANLKASVVFNQL

Задіяний у такому біологічному процесі, як ацетилювання. Локалізований у цитоплазмі.

Література

[ред. | ред. код]
  • Buiakova O.I., Rama Krishna N.S., Getchell T.V., Margolis F.L. (1994). Human and rodent OMP genes: conservation of structural and regulatory motifs and cellular localization. Genomics. 20: 452—462. PMID 8034318 DOI:10.1006/geno.1994.1200
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504

Примітки

[ред. | ред. код]
  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:8136 (англ.) . Процитовано 19 вересня 2017.((cite web)): Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, P47874 (англ.) . Архів оригіналу за 3 жовтня 2017. Процитовано 19 вересня 2017.

Див. також

[ред. | ред. код]
На цю статтю не посилаються інші статті Вікіпедії. Будь ласка розставте посилання відповідно до прийнятих рекомендацій.
{{bottomLinkPreText}} {{bottomLinkText}}
OMP
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?