For faster navigation, this Iframe is preloading the Wikiwand page for OIP5.

OIP5

Матеріал з Вікіпедії — вільної енциклопедії.

OIP5
Ідентифікатори
Символи OIP5, 5730547N13Rik, CT86, LINT-25, MIS18B, MIS18beta, hMIS18beta, Opa interacting protein 5
Зовнішні ІД OMIM: 606020 MGI: 1917895 HomoloGene: 5268 GeneCards: OIP5
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_007280
NM_001317860
NM_001042653
RefSeq (білок)
NP_001304789
NP_009211
NP_001036118
Локус (UCSC) Хр. 15: 41.31 – 41.33 Mb Хр. 2: 119.44 – 119.45 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

OIP5 (англ. Opa interacting protein 5) – білок, який кодується однойменним геном, розташованим у людей на 15-й хромосомі.[3] Довжина поліпептидного ланцюга білка становить 229 амінокислот, а молекулярна маса — 24 691[4].

Послідовність амінокислот
1020304050
MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPL
GPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRS
LGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYS
THAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELK
EKIVLTHNRLKSLMKILSEVTPDQSKPEN

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинний цикл, поділ клітини, мітоз. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у ядрі, хромосомах, центромерах.

Література

[ред. | ред. код]
  • Williams J.M., Chen G.-C., Zhu L., Rest R.F. (1998). Using the yeast two-hybrid system to identify human epithelial cell proteins that bind gonococcal Opa proteins: intracellular gonococci bind pyruvate kinase via their Opa proteins and require host pyruvate for growth. Mol. Microbiol. 27: 171—186. PMID 9466265 DOI:10.1046/j.1365-2958.1998.00670.x
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504

Примітки

[ред. | ред. код]
  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:20300 (англ.) . Процитовано 21 вересня 2017.((cite web)): Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, O43482 (англ.) . Архів оригіналу за 31 серпня 2016. Процитовано 21 вересня 2017.

Див. також

[ред. | ред. код]
На цю статтю не посилаються інші статті Вікіпедії. Будь ласка розставте посилання відповідно до прийнятих рекомендацій.
{{bottomLinkPreText}} {{bottomLinkText}}
OIP5
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?