For faster navigation, this Iframe is preloading the Wikiwand page for MMP7.

MMP7

Матеріал з Вікіпедії — вільної енциклопедії.

MMP7
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MMP7, MMP-7, MPSL1, PUMP-1, matrix metallopeptidase 7
Зовнішні ІД OMIM: 178990 MGI: 103189 HomoloGene: 37619 GeneCards: MMP7
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002423
NM_010810
NM_001319986
RefSeq (білок)
NP_002414
NP_001306915
NP_034940
Локус (UCSC) Хр. 11: 102.52 – 102.53 Mb Хр. 9: 7.69 – 7.7 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MMP7 (англ. Matrix metallopeptidase 7) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 267 амінокислот, а молекулярна маса — 29 677[4].

Послідовність амінокислот
1020304050
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETK
NANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPN
SPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWG
TADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTD
GSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDD
IKGIQKLYGKRSNSRKK

Кодований геном білок за функціями належить до гідролаз, протеаз, металопротеаз. Білок має сайт для зв'язування з іонами металів, іоном цинку, іоном кальцію. Локалізований у позаклітинному матриксі. Також секретований назовні.

Література

[ред. | ред. код]
  • Marti H.P., McNeil L., Thomas G., Davies M., Lovett D.H. (1992). Molecular characterization of a low-molecular-mass matrix metalloproteinase secreted by glomerular mesangial cells as PUMP-1. Biochem. J. 285: 899—905. PMID 1497627 DOI:10.1042/bj2850899
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Quantin B., Murphy G., Breathnach R. (1989). Pump-1 cDNA codes for a protein with characteristics similar to those of classical collagenase family members. Biochemistry. 28: 5327—5334. PMID 2550050 DOI:10.1021/bi00439a004
  • Browner M.F., Smith W.W., Castelhano A.L. (1995). Matrilysin-inhibitor complexes: common themes among metalloproteases. Biochemistry. 34: 6602—6610. PMID 7756291 DOI:10.1021/bi00020a004
  • Miyazaki K., Hattori Y., Umenishi F., Yasumitsu H., Umeda M. (1990). Purification and characterization of extracellular matrix-degrading metalloproteinase, matrin (pump-1), secreted from human rectal carcinoma cell line. Cancer Res. 50: 7758—7764. PMID 2253219

Примітки

[ред. | ред. код]
  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:7174 (англ.) . Архів оригіналу за 15 березня 2016. Процитовано 8 вересня 2017.
  4. UniProt, P09237 (англ.) . Архів оригіналу за 6 жовтня 2017. Процитовано 8 вересня 2017.

Див. також

[ред. | ред. код]
{{bottomLinkPreText}} {{bottomLinkText}}
MMP7
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?