For faster navigation, this Iframe is preloading the Wikiwand page for MDM2.

MDM2

Матеріал з Вікіпедії — вільної енциклопедії.

MDM2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MDM2, ACTFS, HDMX, hdm2, MDM2 proto-oncogene, LSKB
Зовнішні ІД OMIM: 164785 MGI: 96952 HomoloGene: 1793 GeneCards: MDM2
Шаблон експресії




Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001288586
NM_010786
RefSeq (білок)
NP_001275515
NP_034916
Локус (UCSC) Хр. 12: 68.81 – 68.85 Mb Хр. 10: 117.52 – 117.55 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MDM2 (англ. MDM2 proto-oncogene) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 491 амінокислот, а молекулярна маса — 55 233[4].

Послідовність амінокислот
1020304050
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTM
KEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIY
TMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSS
HLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALC
VIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFE
VESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENS
TQAEEGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTS
SSIIYSSQEDVKEFEREETQDKEESVESSLPLNAIEPCVICQGRPKNGCI
VHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP

Кодований геном білок за функціями належить до трансфераз, фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, убіквітинування білків, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, ядрі.

Література

[ред. | ред. код]
  • Oliner J.D., Kinzler K.W., Meltzer P.S., George D.L., Vogelstein B. (1992). Amplification of a gene encoding a p53-associated protein in human sarcomas. Nature. 358: 80—83. PMID 1614537 DOI:10.1038/358080a0
  • Sigalas I., Calvert A.H., Anderson J.J., Neal D.E., Lunec J. (1996). Alternatively spliced mdm2 transcripts with loss of p53 binding domain sequences: transforming ability and frequent detection in human cancer. Nat. Med. 2: 912—917. PMID 8705862 DOI:10.1038/nm0896-912
  • Veldhoen N., Metcalfe S., Milner J. (1999). A novel exon within the mdm2 gene modulates translation initiation in vitro and disrupts the p53-binding domain of mdm2 protein. Oncogene. 18: 7026—7033. PMID 10597303 DOI:10.1038/sj.onc.1203182
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Zauberman A., Flusberg D., Haupt Y., Barak Y., Oren M. (1995). A functional p53-responsive intronic promoter is contained within the human mdm2 gene. Nucleic Acids Res. 23: 2584—2592. PMID 7651818 DOI:10.1093/nar/23.14.2584
  • Liang H., Atkins H., Abdel-Fattah R., Jones S.N., Lunec J. (2004). Genomic organisation of the human MDM2 oncogene and relationship to its alternatively spliced mRNAs. Gene. 338: 217—223. PMID 15315825 DOI:10.1016/j.gene.2004.05.015

Примітки

[ред. | ред. код]
  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:6973 (англ.) . Процитовано 11 вересня 2017.((cite web)): Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, Q00987 (англ.) . Архів оригіналу за 17 вересня 2017. Процитовано 11 вересня 2017.

Див. також

[ред. | ред. код]
{{bottomLinkPreText}} {{bottomLinkText}}
MDM2
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?