For faster navigation, this Iframe is preloading the Wikiwand page for HGD.

HGD

Матеріал з Вікіпедії — вільної енциклопедії.

HGD
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HGD, AKU, HGO, homogentisate 1,2-dioxygenase
Зовнішні ІД OMIM: 607474 MGI: 96078 HomoloGene: 156 GeneCards: HGD
Пов'язані генетичні захворювання
alkaptonuria[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000187
NM_013547
RefSeq (білок)
NP_000178
NP_038575
Локус (UCSC) Хр. 3: 120.63 – 120.68 Mb Хр. 16: 37.4 – 37.45 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HGD (англ. Homogentisate 1,2-dioxygenase) – білок, який кодується однойменним геном, розташованим у людей на 3-й хромосомі.[4] Довжина поліпептидного ланцюга білка становить 445 амінокислот, а молекулярна маса — 49 964[5].

Послідовність амінокислот
1020304050
MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFT
CPRSTNKRSWLYRILPSVSHKPFESIDEGQVTHNWDEVDPDPNQLRWKPF
EIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNS
DGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYI
LEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQ
GKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTV
LTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHY
EAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMF
ESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN

Кодований геном білок за функцією належить до оксидоредуктаз. Задіяний у такому біологічному процесі, як ацетилювання. Білок має сайт для зв'язування з іонами металів, іоном заліза.

Література

[ред. | ред. код]
  • Granadino B., Beltran-Valero de Bernabe D., Fernandez-Canon J.M., Penalva M.A., Rodriguez de Cordoba S. (1997). The human homogentisate 1,2-dioxygenase (HGO) gene. Genomics. 43: 115—122. PMID 9244427 DOI:10.1006/geno.1997.4805
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Beltran-Valero de Bernabe D., Jimenez F.J., Aquaron R., Rodriguez de Cordoba S. (1999). Analysis of alkaptonuria (AKU) mutations and polymorphisms reveals that the CCC sequence motif is a mutational hot spot in the homogentisate 1,2 dioxygenase gene (HGO). Am. J. Hum. Genet. 64: 1316—1322. PMID 10205262 DOI:10.1086/302376
  • Felbor U., Mutsch Y., Grehn F., Mueller C.R., Kress W. (1999). Ocular ochronosis in alkaptonuria patients carrying mutations in the homogentisate 1,2-dioxygenase gene. Br. J. Ophthalmol. 83: 680—683. PMID 10340975 DOI:10.1136/bjo.83.6.680
  • Al-sbou M. (2012). Novel mutations in the homogentisate 1,2 dioxygenase gene identified in Jordanian patients with alkaptonuria. Rheumatol. Int. 32: 1741—1746. PMID 21437689 DOI:10.1007/s00296-011-1868-0

Примітки

[ред. | ред. код]
  1. Захворювання, генетично пов'язані з HGD переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:4892 (англ.) . Процитовано 18 вересня 2017.((cite web)): Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  5. UniProt, Q93099 (англ.) . Архів оригіналу за 26 лютого 2017. Процитовано 18 вересня 2017.

Див. також

[ред. | ред. код]
{{bottomLinkPreText}} {{bottomLinkText}}
HGD
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?