For faster navigation, this Iframe is preloading the Wikiwand page for CSF2.

CSF2

Матеріал з Вікіпедії — вільної енциклопедії.

CSF2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CSF2, GMCSF, colony stimulating factor 2, CSF
Зовнішні ІД OMIM: 138960 MGI: 1339752 HomoloGene: 600 GeneCards: CSF2
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000758
NM_009969
RefSeq (білок)
NP_000749
NP_034099
Локус (UCSC) Хр. 5: 132.07 – 132.08 Mb Хр. 11: 54.14 – 54.14 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CSF2 (англ. Colony stimulating factor 2) — білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 144 амінокислот, а молекулярна маса — 16 295[4].

Послідовність амінокислот
1020304050
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTA
AEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASH
YKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE

Кодований геном білок за функціями належить до цитокінів, факторів росту. Задіяний у такому біологічному процесі, як поліморфізм. Секретований назовні.

Література

[ред. | ред. код]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Kaushansky K., Lopez J.A., Brown C.B. (1992). Role of carbohydrate modification in the production and secretion of human granulocyte macrophage colony-stimulating factor in genetically engineered and normal mesenchymal cells. Biochemistry. 31: 1881—1886. PMID 1737041 DOI:10.1021/bi00121a042
  • Diederichs K., Boone T., Karplus P.A. (1991). Novel fold and putative receptor binding site of granulocyte-macrophage colony-stimulating factor. Science. 254: 1779—1782. PMID 1837174 DOI:10.1126/science.1837174
  • Miyatake S., Otsuka T., Yokota T., Lee F., Arai K. (1985). Structure of the chromosomal gene for granulocyte-macrophage colony stimulating factor: comparison of the mouse and human genes. EMBO J. 4: 2561—2568. PMID 3876930

Примітки

[ред. | ред. код]
  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:2434 (англ.) . Архів оригіналу за 31 серпня 2017. Процитовано 31 серпня 2017.
  4. UniProt, P04141 (англ.) . Архів оригіналу за 31 серпня 2017. Процитовано 31 серпня 2017.

Див. також

[ред. | ред. код]
{{bottomLinkPreText}} {{bottomLinkText}}
CSF2
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?