For faster navigation, this Iframe is preloading the Wikiwand page for CDKN2D.

CDKN2D

Матеріал з Вікіпедії — вільної енциклопедії.

CDKN2D
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CDKN2D, INK4D, p19, p19-INK4D, cyclin-dependent kinase inhibitor 2D, cyclin dependent kinase inhibitor 2D
Зовнішні ІД OMIM: 600927 MGI: 105387 HomoloGene: 36081 GeneCards: CDKN2D
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_079421
NM_001800
NM_009878
RefSeq (білок)
NP_001791
NP_524145
NP_034008
Локус (UCSC) Хр. 19: 10.57 – 10.57 Mb Хр. 9: 21.2 – 21.2 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CDKN2D (англ. Cyclin dependent kinase inhibitor 2D) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 166 амінокислот, а молекулярна маса — 17 700[4].

Послідовність амінокислот
1020304050
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMM
FGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADV
NVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRG
AQDLVDILQGHMVAPL

Задіяний у таких біологічних процесах, як клітинний цикл, ацетилювання. Локалізований у цитоплазмі, ядрі.

Література

[ред. | ред. код]
  • Chan F.K.M., Zhang J., Cheng L., Shapiro D.N., Winoto A. (1995). Identification of human and mouse p19, a novel CDK4 and CDK6 inhibitor with homology to p16ink4. Mol. Cell. Biol. 15: 2682—2688. PMID 7739548 DOI:10.1128/MCB.15.5.2682
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Mahony D., Parry D.A., Lees E. (1998). Active cdk6 complexes are predominantly nuclear and represent only a minority of the cdk6 in T cells. Oncogene. 16: 603—611. PMID 9482106 DOI:10.1038/sj.onc.1201570
  • Russo A.A., Tong L., Lee J.O., Jeffrey P.D., Pavletich N.P. (1998). Structural basis for inhibition of the cyclin-dependent kinase Cdk6 by the tumour suppressor p16INK4a. Nature. 395: 237—243. PMID 9751050 DOI:10.1038/26155

Примітки

[ред. | ред. код]
  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:1790 (англ.) . Процитовано 12 вересня 2017.((cite web)): Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, P55273 (англ.) . Архів оригіналу за 15 вересня 2016. Процитовано 12 вересня 2017.

Див. також

[ред. | ред. код]
{{bottomLinkPreText}} {{bottomLinkText}}
CDKN2D
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?