For faster navigation, this Iframe is preloading the Wikiwand page for CDC42.

CDC42

Матеріал з Вікіпедії — вільної енциклопедії.

CDC42
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CDC42, CDC42Hs, G25K, TKS, cell division cycle 42
Зовнішні ІД OMIM: 116952 HomoloGene: 123986 GeneCards: CDC42
Пов'язані генетичні захворювання
macrothrombocytopenia-lymphedema-developmental delay-facial dysmorphism-camptodactyly syndrome[1]
Шаблон експресії




Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_044472
NM_001039802
NM_001791
NM_001182116
RefSeq (білок)
NP_001034891
NP_001782
NP_426359
NP_013330
Локус (UCSC) Хр. 1: 22.05 – 22.1 Mb н/д
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CDC42 (англ. Cell division cycle 42) — білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 191 амінокислот, а молекулярна маса — 21 259[5].

Послідовність амінокислот
1020304050
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEP
YTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPE
ITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLK
AVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL

Задіяний у таких біологічних процесах як диференціація, нейрогенез. Білок має сайт для зв'язування з нуклеотидами, ГТФ. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані.

Література

[ред. | ред. код]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Kwong C.H., Malech H.L., Rotrosen D., Leto T.L. (1993). Regulation of the human neutrophil NADPH oxidase by rho-related G-proteins. Biochemistry. 32: 5711—5717. PMID 8504089 DOI:10.1021/bi00072a029
  • Polakis P.G., Snyderman R., Evans T. (1989). Characterization of G25K, a GTP-binding protein containing a novel putative nucleotide binding domain. Biochem. Biophys. Res. Commun. 160: 25—32. PMID 2496687 DOI:10.1016/0006-291X(89)91615-X
  • Joberty G., Perlungher R.R., Macara I.G. (1999). The Borgs, a new family of Cdc42 and TC10 GTPase-interacting proteins. Mol. Cell. Biol. 19: 6585—6597. PMID 10490598 DOI:10.1128/MCB.19.10.6585
  • Pirone D.M., Fukuhara S., Gutkind J.S., Burbelo P.D. (2000). SPECs, small binding proteins for Cdc42. J. Biol. Chem. 275: 22650—22656. PMID 10816584 DOI:10.1074/jbc.M002832200
  • Miki H., Yamaguchi H., Suetsugu S., Takenawa T. (2000). IRSp53 is an essential intermediate between Rac and WAVE in the regulation of membrane ruffling. Nature. 408: 732—735. PMID 11130076 DOI:10.1038/35047107

Примітки

[ред. | ред. код]
  1. Захворювання, генетично пов'язані з CDC42 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:1736 (англ.) . Архів оригіналу за 10 жовтня 2017. Процитовано 21 серпня 2017.
  5. UniProt, P60953 (англ.) . Архів оригіналу за 22 липня 2017. Процитовано 21 серпня 2017.

Див. також

[ред. | ред. код]
{{bottomLinkPreText}} {{bottomLinkText}}
CDC42
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?