For faster navigation, this Iframe is preloading the Wikiwand page for Альфа-синуклеїн.

Альфа-синуклеїн

Матеріал з Вікіпедії — вільної енциклопедії.

Α-синуклеїн
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SNCA, NACP, PARK1, PARK4, PD1, synuclein alpha
Зовнішні ІД OMIM: 163890 MGI: 1277151 HomoloGene: 293 GeneCards: SNCA
Пов'язані генетичні захворювання
хвороба Паркінсона, autosomal dominant Parkinson disease 1, autosomal dominant Parkinson disease 4, деменція з тільцями Леві, хвороба Паркінсона, hereditary late onset Parkinson disease[1]
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001042451
NM_009221
RefSeq (білок)
NP_001035916
NP_033247
Локус (UCSC) Хр. 4: 89.7 – 89.84 Mb Хр. 6: 60.71 – 60.81 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Альфа-синуклеїн (англ. Synuclein alpha) — неструктурований білок, що зустрічається у великих кількостях в мозку людей та інших хордових[4][5][6][7]. Кодується геном SNCA, розташованим у людини на довгому плечі 4-ї хромосоми.[8] Довжина поліпептидного ланцюга білка становить 140 амінокислотних залишків, а молекулярна маса — 14 460[9].

Послідовність амінокислот
1020304050
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH
GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL
GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Білок має сайт для зв'язування з іоном міді. Він локалізується переважно в точках контакту нейронів, синапсах. Також секретований назовні.

Структура

[ред. | ред. код]

Прийнято виділяти три основні домени в послідовності α-синуклеїну:

  • амфіфільний N-кінцевий фрагмент (залишки 1-60), що має сильну спорідненість до мембран
  • аполярний NAC регіон (від англійського non-amyloid-β component), що є основною причиною утворення амілоїдних фібрил[5] (залишки 61-95)
  • негативно заряджений гідрофільний C-кінець, що забезпечує розчинність протеїну (залишки 96-140)

Цей поділ є умовним і вказує лишень що дані фрагменти відіграють в наведених взаємодіях більшу роль, ніж інші.

Функція

[ред. | ред. код]

Фізіологічна функція α-синуклеїну ще не з'ясована, але з огляду на локалізацію вважається, що він бере участь в передачі нервових сигналів[4].

Результати досліджень вказують на його взаємодію з ліпідами мембран[10] та низкою білків,[4] а також ймовірну участь у циркуляції синаптичних везикул[11].

α-Синуклеїн є основним компонентом амілоїдних фібрил, що утворюють патологічні агрегати в мозку пацієнтів вражених хворобою Паркінсона.

Мутації

[ред. | ред. код]

Декілька мутацій в послідовності α-синуклеїну призводять до різкого зростання ймовірності розвитку хвороби Паркінсона: A30P, A53T, E56K.[12]. Нещодавно також було повідомлено про патогеність мутацій H50Q,[13] і G51D.[14]

Література

[ред. | ред. код]
  • Ueda K., Saitoh T., Mori H. (1994). Tissue-dependent alternative splicing of mRNA for NACP, the precursor of non-A beta component of Alzheimer's disease amyloid. Biochem. Biophys. Res. Commun. 205: 1366—1372. PMID 7802671 DOI:10.1006/bbrc.1994.2816
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Pronin A.N., Morris A.J., Surguchov A., Benovic J.L. (2000). Synucleins are a novel class of substrates for G protein-coupled receptor kinases. J. Biol. Chem. 275: 26515—26522. PMID 10852916 DOI:10.1074/jbc.M003542200
  • Nakamura T., Yamashita H., Takahashi T., Nakamura S. (2001). Activated Fyn phosphorylates alpha-synuclein at tyrosine residue 125. Biochem. Biophys. Res. Commun. 280: 1085—1092. PMID 11162638 DOI:10.1006/bbrc.2000.4253
  • Alves da Costa C. (2003). Recent advances on alpha-synuclein cell biology: functions and dysfunctions. Curr. Mol. Med. 3: 17—24. PMID 12558071 DOI:10.2174/1566524033361690
  • Waxman E.A., Mazzulli J.R., Giasson B.I. (2009). Characterization of hydrophobic residue requirements for alpha-synuclein fibrillization. Biochemistry. 48: 9427—9436. PMID 19722699 DOI:10.1021/bi900539p

Примітки

[ред. | ред. код]
  1. Захворювання, генетично пов'язані з Α-синуклеїн переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. а б в Genetics Home Reference: SNCA. U.S. National Library of Medicine. 12 листопада 2013. Архів оригіналу за 2 грудня 2013. Процитовано 14 листопада 2013.
  5. а б Uéda K, Fukushima H, Masliah E, Xia Y, Iwai A, Yoshimoto M, Otero DA, Kondo J, Ihara Y, Saitoh T (Dec 1993). Molecular cloning of cDNA encoding an unrecognized component of amyloid in Alzheimer disease. Proceedings of the National Academy of Sciences of the United States of America. Т. 90, № 23. с. 11282—6. doi:10.1073/pnas.90.23.11282. PMC 47966. PMID 8248242. Архів оригіналу за 24 вересня 2015. Процитовано 30 січня 2016.
  6. Xia Y, Saitoh T, Uéda K, Tanaka S, Chen X, Hashimoto M, Hsu L, Conrad C, Sundsmo M, Yoshimoto M, Thal L, Katzman R, Masliah E (Oct 2001). Characterization of the human alpha-synuclein gene: Genomic structure, transcription start site, promoter region and polymorphisms. Journal of Alzheimer's Disease. Т. 3, № 5. с. 485—494. PMID 12214035. Архів оригіналу за 14 травня 2016. Процитовано 30 січня 2016.
  7. Xia Y, Saitoh T, Uéda K, Tanaka S, Chen X, Hashimoto M, Hsu L, Conrad C, Sundsmo M, Yoshimoto M, Thal L, Katzman R, Masliah E (2002). Characterization of the human alpha-synuclein gene: Genomic structure, transcription start site, promoter region and polymorphisms: Erratum p489 Fig 3. J. Alzheimers Dis. Т. 4, № 4. с. 337. Архів оригіналу за 14 травня 2016. Процитовано 30 січня 2016.
  8. HUGO Gene Nomenclature Commitee, HGNC:11138 (англ.) . Архів оригіналу за 28 квітня 2018. Процитовано 26 квітня 2018.
  9. UniProt, P37840 (англ.) . Архів оригіналу за 28 квітня 2018. Процитовано 26 квітня 2018.
  10. Chandra S, Chen X, Rizo J, Jahn R, Südhof TC (Apr 2003). A broken alpha-helix in folded alpha-Synuclein. The Journal of Biological Chemistry. Т. 278, № 17. с. 15313—8. doi:10.1074/jbc.M213128200. PMID 12586824.((cite news)): Обслуговування CS1: Сторінки із непозначеним DOI з безкоштовним доступом (посилання)
  11. Diao J, Burré J, Vivona S, Cipriano DJ, Sharma M, Kyoung M, Südhof TC, Brunger AT (2013). Native α-synuclein induces clustering of synaptic-vesicle mimics via binding to phospholipids and synaptobrevin-2/VAMP2. eLife. Т. 2. с. e00592. doi:10.7554/eLife.00592. PMC 3639508. PMID 23638301.((cite news)): Обслуговування CS1: Сторінки із непозначеним DOI з безкоштовним доступом (посилання)
  12. Polymeropoulos MH, Lavedan C, Leroy E, Ide SE, Dehejia A, Dutra A, Pike B, Root H, Rubenstein J, Boyer R, Stenroos ES, Chandrasekharappa S, Athanassiadou A, Papapetropoulos T, Johnson WG, Lazzarini AM, Duvoisin RC, Di Iorio G, Golbe LI, Nussbaum RL (June 1997). Mutation in the alpha-synuclein gene identified in families with Parkinson's disease. Science. 276 (5321): 2045—7. doi:10.1126/science.276.5321.2045. PMID 9197268. ((cite journal)): Cite має пустий невідомий параметр: |1= (довідка); Недійсний |display-authors=6 (довідка)
  13. Appel-Cresswell S, Vilarino-Guell C, Encarnacion M, Sherman H, Yu I, Shah B, Weir D, Thompson C, Szu-Tu C, Trinh J, Aasly JO, Rajput A, Rajput AH, Jon Stoessl A, Farrer MJ (June 2013). Alpha-synuclein p.H50Q, a novel pathogenic mutation for Parkinson's disease. Movement Disorders. 28 (6): 811—3. doi:10.1002/mds.25421. PMID 23457019. ((cite journal)): Недійсний |display-authors=6 (довідка)
  14. Lesage S, Anheim M, Letournel F, Bousset L, Honoré A, Rozas N, Pieri L, Madiona K, Dürr A, Melki R, Verny C, Brice A (April 2013). G51D α-synuclein mutation causes a novel parkinsonian-pyramidal syndrome. Annals of Neurology. 73 (4): 459—71. doi:10.1002/ana.23894. PMID 23526723. ((cite journal)): Недійсний |display-authors=6 (довідка)

Див. також

[ред. | ред. код]
{{bottomLinkPreText}} {{bottomLinkText}}
Альфа-синуклеїн
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?