For faster navigation, this Iframe is preloading the Wikiwand page for Альфа-лактальбумін.

Альфа-лактальбумін

Матеріал з Вікіпедії — вільної енциклопедії.

LALBA
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи LALBA, entrez:3906, LYZG, lactalbumin alpha, HAMLET
Зовнішні ІД OMIM: 149750 MGI: 96742 HomoloGene: 1720 GeneCards: LALBA
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002289
NM_001384350
NM_010679
RefSeq (білок)
NP_002280
NP_034809
Локус (UCSC) Хр. 12: 48.57 – 48.57 Mb Хр. 15: 98.38 – 98.38 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

LALBA (англ. Lactalbumin alpha) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 142 амінокислот, а молекулярна маса — 16 225[4].

Послідовність амінокислот
1020304050
MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMF
HTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFL
DDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Білок має сайт для зв'язування з іонами металів, іоном кальцію. Секретований назовні.

Література

[ред. | ред. код]
  • Hall L., Craig R.K., Edbrooke M.R., Campbell P.N. (1982). Comparison of the nucleotide sequence of cloned human and guinea-pig pre-alpha-lactalbumin cDNA with that of chick pre-lysozyme cDNA suggests evolution from a common ancestral gene. Nucleic Acids Res. 10: 3503—3515. PMID 6285305 DOI:10.1093/nar/10.11.3503
  • Hall L., Emery D.C., Davies M.S., Parker D., Craig R.K. (1987). Organization and sequence of the human alpha-lactalbumin gene. Biochem. J. 242: 735—742. PMID 2954544 DOI:10.1042/bj2420735
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Findlay J.B.C., Brew K. (1972). The complete amino-acid sequence of human alpha-lactalbumin. Eur. J. Biochem. 27: 65—86. PMID 5049057 DOI:10.1111/j.1432-1033.1972.tb01812.x
  • Picariello G., Ferranti P., Mamone G., Roepstorff P., Addeo F. (2008). Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry. Proteomics. 8: 3833—3847. PMID 18780401 DOI:10.1002/pmic.200701057
  • Acharya K.R., Ren J.S., Stuart D.I., Phillips D.C., Fenna R.E. (1991). Crystal structure of human alpha-lactalbumin at 1.7-A resolution. J. Mol. Biol. 221: 571—581. PMID 1920433 DOI:10.1016/0022-2836(91)80073-4

Примітки

[ред. | ред. код]
  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:6480 (англ.) . Процитовано 11 вересня 2017.((cite web)): Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, P00709 (англ.) . Архів оригіналу за 8 листопада 2017. Процитовано 11 вересня 2017.

Див. також

[ред. | ред. код]


{{bottomLinkPreText}} {{bottomLinkText}}
Альфа-лактальбумін
Listen to this article

This browser is not supported by Wikiwand :(
Wikiwand requires a browser with modern capabilities in order to provide you with the best reading experience.
Please download and use one of the following browsers:

This article was just edited, click to reload
This article has been deleted on Wikipedia (Why?)

Back to homepage

Please click Add in the dialog above
Please click Allow in the top-left corner,
then click Install Now in the dialog
Please click Open in the download dialog,
then click Install
Please click the "Downloads" icon in the Safari toolbar, open the first download in the list,
then click Install
{{::$root.activation.text}}

Install Wikiwand

Install on Chrome Install on Firefox
Don't forget to rate us

Tell your friends about Wikiwand!

Gmail Facebook Twitter Link

Enjoying Wikiwand?

Tell your friends and spread the love:
Share on Gmail Share on Facebook Share on Twitter Share on Buffer

Our magic isn't perfect

You can help our automatic cover photo selection by reporting an unsuitable photo.

This photo is visually disturbing This photo is not a good choice

Thank you for helping!


Your input will affect cover photo selection, along with input from other users.

X

Get ready for Wikiwand 2.0 🎉! the new version arrives on September 1st! Don't want to wait?